TMEM176B (transmembrane protein 176B)

Gene

• Entrez ID: 28959
• Gene name: Transmembrane protein 176B
• Gene symbol: TMEM176B
• Synonyms (NCBI Gene): LR8, MS4B2
• Chromosome: 7
• Chromosome location: 7q36.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1432834	hsa-miR-1294	CLIP-seq
MIRT1432835	hsa-miR-3612	CLIP-seq
MIRT1432836	hsa-miR-4316	CLIP-seq
MIRT1432837	hsa-miR-595	CLIP-seq
MIRT1432838	hsa-miR-650	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0009887	Process	Animal organ morphogenesis	TAS	9922225
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:2001199	Process	Negative regulation of dendritic cell differentiation	IBA
GO:2001199	Process	Negative regulation of dendritic cell differentiation	IEA

Other IDs

• MIM: 610385
• HGNC: 29596
• e!Ensembl: ENSG00000106565

Protein

• UniProt ID: Q3YBM2
• Protein name: Transmembrane protein 176B (Protein LR8)
• Protein function: May play a role in the process of maturation of dendritic cells. Required for the development of cerebellar granule cells (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04103	CD20	66 → 229	CD20-like family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung and dermal fibroblasts. {ECO:0000269|PubMed:9922225}.
• Sequence:

  MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARI
  GYEQLALGVTQILLGVVSCVLGVCLSLGPWTVLSASGCAFWAGSVVIAAGAGAIVHEKHP
  GKLAGYISSLLTLAGFATAMAAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMR
  RSQENQWQKEECRAYMQMLRKLFTAIRALFLAVCVLKVIVSLVSLGVGLRNLCGQSSQPL
  NEEGSEKRLLGENSVPPSPSREQTSTAIVL

• Sequence length: 270

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyloidosis	Amyloidosis	BEFREE	20640189		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24602018		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36969247	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27374485	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22244448		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31085177		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24602018		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	20640189		★☆☆☆☆ Found in Text Mining only