Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2887
Gene name	Growth factor receptor bound protein 10
Gene symbol	GRB10
Synonyms (NCBI Gene)	GRB-IRGrb-10IRBPMEG1RSS
Chromosome	7
Chromosome location	7p12.1
Summary	The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin re

460

Show/Hide all (460)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019136	hsa-miR-335-5p	Microarray	18185580
MIRT020299	hsa-miR-130b-3p	Sequencing	20371350
MIRT046714	hsa-miR-222-3p	CLASH	23622248
MIRT037307	hsa-miR-877-5p	CLASH	23622248
MIRT054627	hsa-miR-199b-5p	ChIP-seqFlowqRT-PCRWestern blot	24608802
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT513910	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT513909	hsa-miR-4295	PAR-CLIP	20371350
MIRT513908	hsa-miR-3666	PAR-CLIP	20371350
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT513904	hsa-miR-3609	PAR-CLIP	20371350
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	20371350
MIRT513901	hsa-miR-1245a	PAR-CLIP	20371350
MIRT513900	hsa-miR-8079	PAR-CLIP	20371350
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT557467	hsa-miR-570-3p	PAR-CLIP	20371350
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT513893	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT513892	hsa-miR-548aw	PAR-CLIP	20371350
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT513910	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT513909	hsa-miR-4295	PAR-CLIP	20371350
MIRT513908	hsa-miR-3666	PAR-CLIP	20371350
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT513904	hsa-miR-3609	PAR-CLIP	20371350
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	20371350
MIRT513901	hsa-miR-1245a	PAR-CLIP	20371350
MIRT513900	hsa-miR-8079	PAR-CLIP	20371350
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT513893	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT513892	hsa-miR-548aw	PAR-CLIP	20371350
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT513910	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT513909	hsa-miR-4295	PAR-CLIP	21572407
MIRT513908	hsa-miR-3666	PAR-CLIP	21572407
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT513904	hsa-miR-3609	PAR-CLIP	21572407
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	21572407
MIRT513901	hsa-miR-1245a	PAR-CLIP	21572407
MIRT513900	hsa-miR-8079	PAR-CLIP	21572407
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT557467	hsa-miR-570-3p	PAR-CLIP	21572407
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT513893	hsa-miR-504-3p	PAR-CLIP	21572407
MIRT513892	hsa-miR-548aw	PAR-CLIP	21572407
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT513910	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT513909	hsa-miR-4295	PAR-CLIP	23446348
MIRT513908	hsa-miR-3666	PAR-CLIP	23446348
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT513904	hsa-miR-3609	PAR-CLIP	23446348
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	23446348
MIRT513901	hsa-miR-1245a	PAR-CLIP	23446348
MIRT513900	hsa-miR-8079	PAR-CLIP	23446348
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT513893	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT513892	hsa-miR-548aw	PAR-CLIP	23446348
MIRT046714	hsa-miR-222-3p	Luciferase reporter assay	26236014
MIRT046714	hsa-miR-222-3p	Luciferase reporter assay	26236014
MIRT733050	hsa-miR-5195-3p	Luciferase reporter assayWestern blottingqRT-PCR	33969901
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT513910	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT513909	hsa-miR-4295	PAR-CLIP	20371350
MIRT513908	hsa-miR-3666	PAR-CLIP	20371350
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT513904	hsa-miR-3609	PAR-CLIP	20371350
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	20371350
MIRT513901	hsa-miR-1245a	PAR-CLIP	20371350
MIRT513900	hsa-miR-8079	PAR-CLIP	20371350
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT557467	hsa-miR-570-3p	PAR-CLIP	20371350
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT513893	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT513892	hsa-miR-548aw	PAR-CLIP	20371350
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT513910	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT513909	hsa-miR-4295	PAR-CLIP	20371350
MIRT513908	hsa-miR-3666	PAR-CLIP	20371350
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT513904	hsa-miR-3609	PAR-CLIP	20371350
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	20371350
MIRT513901	hsa-miR-1245a	PAR-CLIP	20371350
MIRT513900	hsa-miR-8079	PAR-CLIP	20371350
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT513893	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT513892	hsa-miR-548aw	PAR-CLIP	20371350
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT513910	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT513909	hsa-miR-4295	PAR-CLIP	21572407
MIRT513908	hsa-miR-3666	PAR-CLIP	21572407
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT513904	hsa-miR-3609	PAR-CLIP	21572407
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	21572407
MIRT513901	hsa-miR-1245a	PAR-CLIP	21572407
MIRT513900	hsa-miR-8079	PAR-CLIP	21572407
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT557467	hsa-miR-570-3p	PAR-CLIP	21572407
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT513893	hsa-miR-504-3p	PAR-CLIP	21572407
MIRT513892	hsa-miR-548aw	PAR-CLIP	21572407
MIRT513914	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT513913	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT513912	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT020299	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT513911	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT513910	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT513909	hsa-miR-4295	PAR-CLIP	23446348
MIRT513908	hsa-miR-3666	PAR-CLIP	23446348
MIRT513907	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT513906	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT513905	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT513904	hsa-miR-3609	PAR-CLIP	23446348
MIRT513903	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT513902	hsa-miR-4433b-3p	PAR-CLIP	23446348
MIRT513901	hsa-miR-1245a	PAR-CLIP	23446348
MIRT513900	hsa-miR-8079	PAR-CLIP	23446348
MIRT513899	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT513898	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT513897	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT513896	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT513895	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT513894	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT513893	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT513892	hsa-miR-548aw	PAR-CLIP	23446348
MIRT1032995	hsa-miR-105	CLIP-seq
MIRT1032996	hsa-miR-1203	CLIP-seq
MIRT1032997	hsa-miR-125a-5p	CLIP-seq
MIRT1032998	hsa-miR-125b	CLIP-seq
MIRT1032999	hsa-miR-1270	CLIP-seq
MIRT1033000	hsa-miR-127-5p	CLIP-seq
MIRT1033001	hsa-miR-1297	CLIP-seq
MIRT1033002	hsa-miR-1299	CLIP-seq
MIRT1033003	hsa-miR-1305	CLIP-seq
MIRT1033004	hsa-miR-1323	CLIP-seq
MIRT1033005	hsa-miR-141	CLIP-seq
MIRT1033006	hsa-miR-151-3p	CLIP-seq
MIRT1033007	hsa-miR-181a	CLIP-seq
MIRT1033008	hsa-miR-181b	CLIP-seq
MIRT1033009	hsa-miR-181c	CLIP-seq
MIRT1033010	hsa-miR-181d	CLIP-seq
MIRT1033011	hsa-miR-1827	CLIP-seq
MIRT1033012	hsa-miR-185	CLIP-seq
MIRT1033013	hsa-miR-1972	CLIP-seq
MIRT1033014	hsa-miR-1976	CLIP-seq
MIRT1033015	hsa-miR-200a	CLIP-seq
MIRT1033016	hsa-miR-2116	CLIP-seq
MIRT1033017	hsa-miR-26a	CLIP-seq
MIRT1033018	hsa-miR-26b	CLIP-seq
MIRT1033019	hsa-miR-300	CLIP-seq
MIRT1033020	hsa-miR-31	CLIP-seq
MIRT1033021	hsa-miR-3117-5p	CLIP-seq
MIRT1033022	hsa-miR-3127-3p	CLIP-seq
MIRT1033023	hsa-miR-3133	CLIP-seq
MIRT1033024	hsa-miR-3155	CLIP-seq
MIRT1033025	hsa-miR-3155b	CLIP-seq
MIRT1033026	hsa-miR-3160-3p	CLIP-seq
MIRT1033027	hsa-miR-3190	CLIP-seq
MIRT1033028	hsa-miR-3199	CLIP-seq
MIRT1033029	hsa-miR-3202	CLIP-seq
MIRT1033030	hsa-miR-345	CLIP-seq
MIRT1033031	hsa-miR-381	CLIP-seq
MIRT1033032	hsa-miR-3913-3p	CLIP-seq
MIRT1033033	hsa-miR-3929	CLIP-seq
MIRT1033034	hsa-miR-3944-5p	CLIP-seq
MIRT1033035	hsa-miR-409-3p	CLIP-seq
MIRT1033036	hsa-miR-421	CLIP-seq
MIRT1033037	hsa-miR-4262	CLIP-seq
MIRT1033038	hsa-miR-4263	CLIP-seq
MIRT1033039	hsa-miR-4275	CLIP-seq
MIRT1033040	hsa-miR-4306	CLIP-seq
MIRT1033041	hsa-miR-4319	CLIP-seq
MIRT1033042	hsa-miR-4325	CLIP-seq
MIRT1033043	hsa-miR-4328	CLIP-seq
MIRT1033044	hsa-miR-4419b	CLIP-seq
MIRT1033045	hsa-miR-4438	CLIP-seq
MIRT1033046	hsa-miR-4446-3p	CLIP-seq
MIRT1033047	hsa-miR-4463	CLIP-seq
MIRT1033048	hsa-miR-4465	CLIP-seq
MIRT1033049	hsa-miR-4478	CLIP-seq
MIRT1033050	hsa-miR-4487	CLIP-seq
MIRT1033051	hsa-miR-4499	CLIP-seq
MIRT1033052	hsa-miR-4504	CLIP-seq
MIRT1033053	hsa-miR-4513	CLIP-seq
MIRT1033054	hsa-miR-4515	CLIP-seq
MIRT1033055	hsa-miR-4531	CLIP-seq
MIRT1033056	hsa-miR-4644	CLIP-seq
MIRT1033057	hsa-miR-4646-5p	CLIP-seq
MIRT1033058	hsa-miR-4649-3p	CLIP-seq
MIRT1033059	hsa-miR-4659a-3p	CLIP-seq
MIRT1033060	hsa-miR-4659b-3p	CLIP-seq
MIRT1033061	hsa-miR-4677-5p	CLIP-seq
MIRT1033062	hsa-miR-4680-5p	CLIP-seq
MIRT1033063	hsa-miR-4685-5p	CLIP-seq
MIRT1033064	hsa-miR-4706	CLIP-seq
MIRT1033065	hsa-miR-4709-5p	CLIP-seq
MIRT1033066	hsa-miR-4719	CLIP-seq
MIRT1033067	hsa-miR-4724-5p	CLIP-seq
MIRT1033068	hsa-miR-4726-3p	CLIP-seq
MIRT1033069	hsa-miR-4732-3p	CLIP-seq
MIRT1033070	hsa-miR-4735-5p	CLIP-seq
MIRT1033071	hsa-miR-4742-3p	CLIP-seq
MIRT1033072	hsa-miR-4747-5p	CLIP-seq
MIRT1033073	hsa-miR-4749-5p	CLIP-seq
MIRT1033074	hsa-miR-4752	CLIP-seq
MIRT1033075	hsa-miR-4755-3p	CLIP-seq
MIRT1033076	hsa-miR-4761-5p	CLIP-seq
MIRT1033077	hsa-miR-4766-3p	CLIP-seq
MIRT1033078	hsa-miR-4781-5p	CLIP-seq
MIRT1033079	hsa-miR-4782-5p	CLIP-seq
MIRT1033080	hsa-miR-4789-5p	CLIP-seq
MIRT1033081	hsa-miR-4793-3p	CLIP-seq
MIRT1033082	hsa-miR-4796-5p	CLIP-seq
MIRT1033083	hsa-miR-484	CLIP-seq
MIRT1033084	hsa-miR-489	CLIP-seq
MIRT1033085	hsa-miR-498	CLIP-seq
MIRT1033086	hsa-miR-499-3p	CLIP-seq
MIRT1033087	hsa-miR-499a-3p	CLIP-seq
MIRT1033088	hsa-miR-505	CLIP-seq
MIRT1033089	hsa-miR-507	CLIP-seq
MIRT1033090	hsa-miR-516b	CLIP-seq
MIRT1033091	hsa-miR-520g	CLIP-seq
MIRT1033092	hsa-miR-520h	CLIP-seq
MIRT1033093	hsa-miR-542-3p	CLIP-seq
MIRT1033094	hsa-miR-543	CLIP-seq
MIRT1033095	hsa-miR-548n	CLIP-seq
MIRT1033096	hsa-miR-548o	CLIP-seq
MIRT1033097	hsa-miR-548p	CLIP-seq
MIRT1033098	hsa-miR-548t	CLIP-seq
MIRT1033099	hsa-miR-548u	CLIP-seq
MIRT1033100	hsa-miR-557	CLIP-seq
MIRT1033101	hsa-miR-558	CLIP-seq
MIRT1033102	hsa-miR-570	CLIP-seq
MIRT1033103	hsa-miR-576-5p	CLIP-seq
MIRT1033104	hsa-miR-579	CLIP-seq
MIRT1033105	hsa-miR-598	CLIP-seq
MIRT1033106	hsa-miR-618	CLIP-seq
MIRT1033107	hsa-miR-620	CLIP-seq
MIRT1033108	hsa-miR-626	CLIP-seq
MIRT1033109	hsa-miR-645	CLIP-seq
MIRT1033110	hsa-miR-670	CLIP-seq
MIRT1033111	hsa-miR-758	CLIP-seq
MIRT1033112	hsa-miR-764	CLIP-seq
MIRT1033113	hsa-miR-875-3p	CLIP-seq
MIRT1033039	hsa-miR-4275	CLIP-seq
MIRT1033059	hsa-miR-4659a-3p	CLIP-seq
MIRT1033060	hsa-miR-4659b-3p	CLIP-seq
MIRT1033076	hsa-miR-4761-5p	CLIP-seq
MIRT1033077	hsa-miR-4766-3p	CLIP-seq
MIRT1033097	hsa-miR-548p	CLIP-seq
MIRT1556475	hsa-miR-4802-3p	CLIP-seq
MIRT1033006	hsa-miR-151-3p	CLIP-seq
MIRT2006464	hsa-miR-15a	CLIP-seq
MIRT2006465	hsa-miR-15b	CLIP-seq
MIRT2006466	hsa-miR-16	CLIP-seq
MIRT2006467	hsa-miR-195	CLIP-seq
MIRT2006468	hsa-miR-214	CLIP-seq
MIRT2006469	hsa-miR-27a	CLIP-seq
MIRT2006470	hsa-miR-27b	CLIP-seq
MIRT1033020	hsa-miR-31	CLIP-seq
MIRT2006471	hsa-miR-3136-3p	CLIP-seq
MIRT2006472	hsa-miR-3137	CLIP-seq
MIRT2006473	hsa-miR-34b	CLIP-seq
MIRT2006474	hsa-miR-3619-5p	CLIP-seq
MIRT1033032	hsa-miR-3913-3p	CLIP-seq
MIRT2006475	hsa-miR-424	CLIP-seq
MIRT2006476	hsa-miR-4326	CLIP-seq
MIRT2006477	hsa-miR-4435	CLIP-seq
MIRT1033047	hsa-miR-4463	CLIP-seq
MIRT1033051	hsa-miR-4499	CLIP-seq
MIRT1033052	hsa-miR-4504	CLIP-seq
MIRT1033053	hsa-miR-4513	CLIP-seq
MIRT2006478	hsa-miR-4527	CLIP-seq
MIRT1033063	hsa-miR-4685-5p	CLIP-seq
MIRT2006479	hsa-miR-4705	CLIP-seq
MIRT2006480	hsa-miR-4731-5p	CLIP-seq
MIRT2006481	hsa-miR-4768-5p	CLIP-seq
MIRT1033084	hsa-miR-489	CLIP-seq
MIRT2006482	hsa-miR-497	CLIP-seq
MIRT2006483	hsa-miR-513a-5p	CLIP-seq
MIRT2006484	hsa-miR-545	CLIP-seq
MIRT2006485	hsa-miR-578	CLIP-seq
MIRT1033104	hsa-miR-579	CLIP-seq
MIRT2006486	hsa-miR-671-3p	CLIP-seq
MIRT2006487	hsa-miR-761	CLIP-seq
MIRT2006488	hsa-miR-942	CLIP-seq
MIRT2238918	hsa-miR-1237	CLIP-seq
MIRT1033007	hsa-miR-181a	CLIP-seq
MIRT1033008	hsa-miR-181b	CLIP-seq
MIRT1033009	hsa-miR-181c	CLIP-seq
MIRT1033010	hsa-miR-181d	CLIP-seq
MIRT2238919	hsa-miR-221	CLIP-seq
MIRT2238920	hsa-miR-222	CLIP-seq
MIRT2238921	hsa-miR-330-3p	CLIP-seq
MIRT1033037	hsa-miR-4262	CLIP-seq
MIRT2238922	hsa-miR-513c	CLIP-seq
MIRT2238923	hsa-miR-514b-5p	CLIP-seq
MIRT2238924	hsa-miR-633	CLIP-seq
MIRT2238918	hsa-miR-1237	CLIP-seq
MIRT2238925	hsa-miR-1245	CLIP-seq
MIRT2006464	hsa-miR-15a	CLIP-seq
MIRT2006465	hsa-miR-15b	CLIP-seq
MIRT2006466	hsa-miR-16	CLIP-seq
MIRT1033007	hsa-miR-181a	CLIP-seq
MIRT1033008	hsa-miR-181b	CLIP-seq
MIRT1033009	hsa-miR-181c	CLIP-seq
MIRT1033010	hsa-miR-181d	CLIP-seq
MIRT2006467	hsa-miR-195	CLIP-seq
MIRT2006468	hsa-miR-214	CLIP-seq
MIRT2238919	hsa-miR-221	CLIP-seq
MIRT2238920	hsa-miR-222	CLIP-seq
MIRT2238921	hsa-miR-330-3p	CLIP-seq
MIRT2238926	hsa-miR-338-5p	CLIP-seq
MIRT2006474	hsa-miR-3619-5p	CLIP-seq
MIRT2006475	hsa-miR-424	CLIP-seq
MIRT1033037	hsa-miR-4262	CLIP-seq
MIRT1033045	hsa-miR-4438	CLIP-seq
MIRT2006482	hsa-miR-497	CLIP-seq
MIRT2006483	hsa-miR-513a-5p	CLIP-seq
MIRT2238922	hsa-miR-513c	CLIP-seq
MIRT2238923	hsa-miR-514b-5p	CLIP-seq
MIRT1033094	hsa-miR-543	CLIP-seq
MIRT2238927	hsa-miR-548m	CLIP-seq
MIRT2006487	hsa-miR-761	CLIP-seq
MIRT2388751	hsa-miR-3919	CLIP-seq
MIRT2388752	hsa-miR-539	CLIP-seq
MIRT1033020	hsa-miR-31	CLIP-seq
MIRT2006473	hsa-miR-34b	CLIP-seq
MIRT2006476	hsa-miR-4326	CLIP-seq
MIRT1033063	hsa-miR-4685-5p	CLIP-seq
MIRT2006479	hsa-miR-4705	CLIP-seq
MIRT2006481	hsa-miR-4768-5p	CLIP-seq
MIRT2006485	hsa-miR-578	CLIP-seq
MIRT1033104	hsa-miR-579	CLIP-seq
MIRT2006486	hsa-miR-671-3p	CLIP-seq
MIRT2006488	hsa-miR-942	CLIP-seq
MIRT2542829	hsa-miR-103a	CLIP-seq
MIRT2542830	hsa-miR-107	CLIP-seq
MIRT2542831	hsa-miR-1184	CLIP-seq
MIRT2542832	hsa-miR-124	CLIP-seq
MIRT2542833	hsa-miR-1273d	CLIP-seq
MIRT2006464	hsa-miR-15a	CLIP-seq
MIRT2006465	hsa-miR-15b	CLIP-seq
MIRT2006466	hsa-miR-16	CLIP-seq
MIRT2542834	hsa-miR-1909	CLIP-seq
MIRT2006467	hsa-miR-195	CLIP-seq
MIRT2006468	hsa-miR-214	CLIP-seq
MIRT2542835	hsa-miR-2682	CLIP-seq
MIRT1033021	hsa-miR-3117-5p	CLIP-seq
MIRT2542836	hsa-miR-3136-5p	CLIP-seq
MIRT2542837	hsa-miR-3150b-3p	CLIP-seq
MIRT2542838	hsa-miR-3162-5p	CLIP-seq
MIRT2542839	hsa-miR-326	CLIP-seq
MIRT2542840	hsa-miR-330-5p	CLIP-seq
MIRT2006474	hsa-miR-3619-5p	CLIP-seq
MIRT2542841	hsa-miR-3714	CLIP-seq
MIRT2542842	hsa-miR-3910	CLIP-seq
MIRT2388751	hsa-miR-3919	CLIP-seq
MIRT2006475	hsa-miR-424	CLIP-seq
MIRT2542843	hsa-miR-4276	CLIP-seq
MIRT2006476	hsa-miR-4326	CLIP-seq
MIRT2542844	hsa-miR-4418	CLIP-seq
MIRT2542845	hsa-miR-4439	CLIP-seq
MIRT2542846	hsa-miR-4468	CLIP-seq
MIRT2542847	hsa-miR-449c	CLIP-seq
MIRT1033053	hsa-miR-4513	CLIP-seq
MIRT2542848	hsa-miR-4689	CLIP-seq
MIRT2542849	hsa-miR-4784	CLIP-seq
MIRT2542850	hsa-miR-4787-5p	CLIP-seq
MIRT2542851	hsa-miR-495	CLIP-seq
MIRT2006482	hsa-miR-497	CLIP-seq
MIRT2542852	hsa-miR-506	CLIP-seq
MIRT2542853	hsa-miR-509-3-5p	CLIP-seq
MIRT2542854	hsa-miR-509-5p	CLIP-seq
MIRT2388752	hsa-miR-539	CLIP-seq
MIRT2542855	hsa-miR-555	CLIP-seq
MIRT2542856	hsa-miR-563	CLIP-seq
MIRT1033109	hsa-miR-645	CLIP-seq
MIRT2542857	hsa-miR-720	CLIP-seq
MIRT2006487	hsa-miR-761	CLIP-seq
MIRT2542858	hsa-miR-943	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005158	Function	Insulin receptor binding	IBA
GO:0005158	Function	Insulin receptor binding	IEA
GO:0005158	Function	Insulin receptor binding	ISS	15664450
GO:0005515	Function	Protein binding	IPI	8798570, 9506989, 15060076, 15722337, 20670374, 20878056, 23246379, 24658140, 25814554, 31980649, 32296183, 32814053, 35271311, 36931259
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9006901
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS	9006901
GO:0007165	Process	Signal transduction	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0010467	Process	Gene expression	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IBA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	17376403
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	15060076
GO:0032868	Process	Response to insulin	ISS
GO:0032991	Component	Protein-containing complex	IDA	20878056
GO:0042327	Process	Positive regulation of phosphorylation	ISS
GO:0042802	Function	Identical protein binding	IPI	19648926, 32296183
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	ISS
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046325	Process	Negative regulation of D-glucose import	ISS	15664450
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IBA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS	15664450
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24746805
GO:1904738	Process	Vascular associated smooth muscle cell migration	IEA

MIM	HGNC	e!Ensembl
601523	4564	ENSG00000106070

Q13322

Protein name

Growth factor receptor-bound protein 10 (GRB10 adapter protein) (Insulin receptor-binding protein Grb-IR)

Protein function

Adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. Binds to, and suppress signals from, activated receptors tyrosine kinases, including the insulin (INSR) and insulin-like grow

PDB

1NRV , 3HK0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	166 → 250	Ras association (RalGDS/AF-6) domain	Domain
PF00169	PH	291 → 399	PH domain	Domain
PF08947	BPS	425 → 471	BPS (Between PH and SH2)	Domain
PF00017	SH2	493 → 574	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in fetal and adult tissues, including fetal and postnatal liver, lung, kidney, skeletal muscle, heart, spleen, skin and brain. {ECO:0000269|PubMed:11527390}.

Sequence

MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVK
ELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDH
GLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHP
STLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIK
NFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL

Sequence length

594

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway		Signaling by SCF-KIT IRS activation Signal attenuation Insulin receptor signalling cascade RET signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOMAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRB10-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SILVER-RUSSELL SYNDROME DUE TO MATERNAL UNIPARENTAL DISOMY OF CHROMOSOME 7	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT REFRACTORY SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Achondroplasia	Achondroplasia	BEFREE	27370225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	27370225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	21481762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25391383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	29721936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	12510981, 20933618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	35571247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25560175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	39988826	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24190013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24190013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21978709, 35924107, 37535601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	21779181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	25119929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25375650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23552671, 26418287, 37356726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29476072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23552671, 24699409, 26418287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	27651465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	12514746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24190013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25119929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	27370225, 33187293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	33407475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	23761422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	9881709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31794259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35571247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30376373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29476072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	29476072	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	29476072		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25249015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23246379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34906185	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27974694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29544736, 30379590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36716920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	18167544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28131743, 29544736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23034519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30376373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27974694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	27861377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASDB_DG	23512250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29544736, 30379590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoparathyroidism	Pseudohypoparathyroidism	Pubtator	22679513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	30376373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	9895244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10372988, 11597600, 11934446, 7928191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	10631135, 10856193, 10987657, 11112662, 11313740, 11527390, 12514746, 14724735, 17551927, 19174477, 27370225, 31100449, 9448292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25119929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25223841		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	25223841		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	27651465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15870923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	GWASCAT_DG	21779181		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	21779181		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	30400009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	23761422		★★★★★ ★☆☆☆☆ Found in Text Mining only

GRB10 (growth factor receptor bound protein 10)