GRB7 (growth factor receptor bound protein 7)

Gene

• Entrez ID: 2886
• Gene name: Growth factor receptor bound protein 7
• Gene symbol: GRB7
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q12
• Summary: The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016993	hsa-miR-335-5p	Microarray	18185580
MIRT028909	hsa-miR-26b-5p	Microarray	19088304
MIRT1033299	hsa-miR-1193	CLIP-seq
MIRT1033300	hsa-miR-1243	CLIP-seq
MIRT1033301	hsa-miR-1293	CLIP-seq
MIRT1033302	hsa-miR-1321	CLIP-seq
MIRT1033303	hsa-miR-3126-5p	CLIP-seq
MIRT1033304	hsa-miR-3180	CLIP-seq
MIRT1033305	hsa-miR-3180-3p	CLIP-seq
MIRT1033306	hsa-miR-3184	CLIP-seq
MIRT1033307	hsa-miR-3196	CLIP-seq
MIRT1033308	hsa-miR-3200-5p	CLIP-seq
MIRT1033309	hsa-miR-3612	CLIP-seq
MIRT1033310	hsa-miR-3960	CLIP-seq
MIRT1033311	hsa-miR-423-5p	CLIP-seq
MIRT1033312	hsa-miR-4419a	CLIP-seq
MIRT1033313	hsa-miR-4467	CLIP-seq
MIRT1033314	hsa-miR-4483	CLIP-seq
MIRT1033315	hsa-miR-4510	CLIP-seq
MIRT1033316	hsa-miR-4649-3p	CLIP-seq
MIRT1033317	hsa-miR-4739	CLIP-seq
MIRT1033318	hsa-miR-4756-5p	CLIP-seq
MIRT1033319	hsa-miR-650	CLIP-seq
MIRT1033320	hsa-miR-122	CLIP-seq
MIRT1033321	hsa-miR-1269	CLIP-seq
MIRT1033322	hsa-miR-1269b	CLIP-seq
MIRT1033323	hsa-miR-1288	CLIP-seq
MIRT1033324	hsa-miR-4433	CLIP-seq
MIRT1033325	hsa-miR-4447	CLIP-seq
MIRT1033326	hsa-miR-4459	CLIP-seq
MIRT1033327	hsa-miR-4472	CLIP-seq
MIRT1033328	hsa-miR-4481	CLIP-seq
MIRT1033329	hsa-miR-4488	CLIP-seq
MIRT1033330	hsa-miR-4515	CLIP-seq
MIRT1033331	hsa-miR-4697-5p	CLIP-seq
MIRT1033332	hsa-miR-4740-5p	CLIP-seq
MIRT1033333	hsa-miR-4745-5p	CLIP-seq
MIRT1033334	hsa-miR-4768-3p	CLIP-seq
MIRT1033299	hsa-miR-1193	CLIP-seq
MIRT1033300	hsa-miR-1243	CLIP-seq
MIRT1033320	hsa-miR-122	CLIP-seq
MIRT2238945	hsa-miR-1224-5p	CLIP-seq
MIRT2238946	hsa-miR-1268	CLIP-seq
MIRT2238947	hsa-miR-1268b	CLIP-seq
MIRT1033321	hsa-miR-1269	CLIP-seq
MIRT1033322	hsa-miR-1269b	CLIP-seq
MIRT1033323	hsa-miR-1288	CLIP-seq
MIRT2238948	hsa-miR-1827	CLIP-seq
MIRT2238949	hsa-miR-193a-3p	CLIP-seq
MIRT2238950	hsa-miR-193b	CLIP-seq
MIRT2238951	hsa-miR-204	CLIP-seq
MIRT2238952	hsa-miR-211	CLIP-seq
MIRT2238953	hsa-miR-2278	CLIP-seq
MIRT2238954	hsa-miR-3150b-3p	CLIP-seq
MIRT2238955	hsa-miR-3151	CLIP-seq
MIRT2238956	hsa-miR-3163	CLIP-seq
MIRT2238957	hsa-miR-3176	CLIP-seq
MIRT1033304	hsa-miR-3180	CLIP-seq
MIRT1033305	hsa-miR-3180-3p	CLIP-seq
MIRT1033307	hsa-miR-3196	CLIP-seq
MIRT2238958	hsa-miR-3615	CLIP-seq
MIRT2238959	hsa-miR-3915	CLIP-seq
MIRT2238960	hsa-miR-3922-3p	CLIP-seq
MIRT2238961	hsa-miR-3923	CLIP-seq
MIRT1033310	hsa-miR-3960	CLIP-seq
MIRT2238962	hsa-miR-4293	CLIP-seq
MIRT2238963	hsa-miR-4297	CLIP-seq
MIRT1033324	hsa-miR-4433	CLIP-seq
MIRT1033325	hsa-miR-4447	CLIP-seq
MIRT1033326	hsa-miR-4459	CLIP-seq
MIRT1033313	hsa-miR-4467	CLIP-seq
MIRT2238964	hsa-miR-4468	CLIP-seq
MIRT1033327	hsa-miR-4472	CLIP-seq
MIRT1033328	hsa-miR-4481	CLIP-seq
MIRT1033329	hsa-miR-4488	CLIP-seq
MIRT2238965	hsa-miR-4493	CLIP-seq
MIRT1033330	hsa-miR-4515	CLIP-seq
MIRT2238966	hsa-miR-455-3p	CLIP-seq
MIRT1033316	hsa-miR-4649-3p	CLIP-seq
MIRT2238967	hsa-miR-4656	CLIP-seq
MIRT2238968	hsa-miR-4675	CLIP-seq
MIRT2238969	hsa-miR-4676-5p	CLIP-seq
MIRT2238970	hsa-miR-4687-3p	CLIP-seq
MIRT2238971	hsa-miR-4689	CLIP-seq
MIRT1033331	hsa-miR-4697-5p	CLIP-seq
MIRT1033332	hsa-miR-4740-5p	CLIP-seq
MIRT2238972	hsa-miR-4741	CLIP-seq
MIRT1033333	hsa-miR-4745-5p	CLIP-seq
MIRT2238973	hsa-miR-4755-5p	CLIP-seq
MIRT2238974	hsa-miR-4757-5p	CLIP-seq
MIRT1033334	hsa-miR-4768-3p	CLIP-seq
MIRT2238975	hsa-miR-4780	CLIP-seq
MIRT2238976	hsa-miR-4784	CLIP-seq
MIRT2238977	hsa-miR-491-5p	CLIP-seq
MIRT2238978	hsa-miR-520d-5p	CLIP-seq
MIRT2238979	hsa-miR-520g	CLIP-seq
MIRT2238980	hsa-miR-520h	CLIP-seq
MIRT2238981	hsa-miR-524-5p	CLIP-seq
MIRT2238982	hsa-miR-575	CLIP-seq
MIRT2238983	hsa-miR-595	CLIP-seq
MIRT2238984	hsa-miR-623	CLIP-seq
MIRT2238985	hsa-miR-668	CLIP-seq
MIRT1033299	hsa-miR-1193	CLIP-seq
MIRT1033301	hsa-miR-1293	CLIP-seq
MIRT1033304	hsa-miR-3180	CLIP-seq
MIRT1033305	hsa-miR-3180-3p	CLIP-seq
MIRT1033306	hsa-miR-3184	CLIP-seq
MIRT1033307	hsa-miR-3196	CLIP-seq
MIRT1033310	hsa-miR-3960	CLIP-seq
MIRT1033311	hsa-miR-423-5p	CLIP-seq
MIRT1033313	hsa-miR-4467	CLIP-seq
MIRT1033314	hsa-miR-4483	CLIP-seq
MIRT2238945	hsa-miR-1224-5p	CLIP-seq
MIRT2542908	hsa-miR-1245b-5p	CLIP-seq
MIRT2238951	hsa-miR-204	CLIP-seq
MIRT2238952	hsa-miR-211	CLIP-seq
MIRT2542909	hsa-miR-3142	CLIP-seq
MIRT2238954	hsa-miR-3150b-3p	CLIP-seq
MIRT2238959	hsa-miR-3915	CLIP-seq
MIRT2542910	hsa-miR-3922-5p	CLIP-seq
MIRT2238963	hsa-miR-4297	CLIP-seq
MIRT2238971	hsa-miR-4689	CLIP-seq
MIRT2238973	hsa-miR-4755-5p	CLIP-seq
MIRT2238975	hsa-miR-4780	CLIP-seq
MIRT2238976	hsa-miR-4784	CLIP-seq
MIRT2238984	hsa-miR-623	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	8940081, 9079677, 9516479, 10377264, 10664463, 12061724, 12223469, 12852788, 12975581, 15806159, 16273093, 20665473, 24189400, 24728074, 25416956, 25814554, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10893408, 12021278
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	10893408, 12021278
GO:0005925	Component	Focal adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS	9710451
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0016020	Component	Membrane	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	ISS
GO:0019901	Function	Protein kinase binding	IDA	12021278
GO:0030335	Process	Positive regulation of cell migration	IDA	10893408, 12021278
GO:0034063	Process	Stress granule assembly	IEA
GO:0034063	Process	Stress granule assembly	ISS
GO:0035091	Function	Phosphatidylinositol binding	IDA	12021278
GO:0042802	Function	Identical protein binding	IPI	15841400
GO:0042995	Component	Cell projection	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IBA
GO:0070161	Component	Anchoring junction	IEA

Other IDs

• MIM: 601522
• HGNC: 4567
• e!Ensembl: ENSG00000141738

Protein

• UniProt ID: Q14451
• Protein name: Growth factor receptor-bound protein 7 (B47) (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein)
• Protein function: Adapter protein that interacts with the cytoplasmic domain of numerous receptor kinases and modulates down-stream signaling. Promotes activation of down-stream protein kinases, including STAT3, AKT1, MAPK1 and/or MAPK3. Promotes activation of HR
• PDB: 1MW4, 1WGR, 2L4K, 2QMS, 3PQZ, 4WWQ, 4X6S, 5D0J, 5EEL, 5EEQ, 5TYI, 5U06, 5U1Q, 7MP3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00788	RA	100 → 186	Ras association (RalGDS/AF-6) domain	Domain
  PF00169	PH	230 → 338	PH domain	Domain
  PF08947	BPS	365 → 412	BPS (Between PH and SH2)	Domain
  PF00017	SH2	431 → 512	SH2 domain	Domain

• Sequence:

  MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERR
  ATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA
  GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFV
  FRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
  SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
  FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLG
  SPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS
  LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY
  LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL

• Sequence length: 532

Pathways

Reactome:

GRB7 events in ERBB2 signaling
Signaling by SCF-KIT
Downstream signal transduction
Tie2 Signaling
RET signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16778393	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15386389		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12866037, 15010812, 16322295, 20126311, 20622016, 20635137, 21788678, 24464577, 25182704, 26400847, 29083893, 30604896, 31627265, 7907978, 8988034		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17426702, 19075277		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10664463, 16475676, 18853468, 19717535, 21288332, 22253820, 23714731, 24194916, 26975656, 28295715, 31017268, 31627265, 33191115, 38036593	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	16849266	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	25906114	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18853468, 30696738	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15386389, 8988034, 9710451		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22253820	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37525498	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20388850, 26617853		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28780081		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28780081		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15470489		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15470489		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	8525475		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	8525475		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15511476, 8988034, 9710451		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15511476, 9710451		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22253820, 9710451	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26465158	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	9409191	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	1633650		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17634422		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	12866037, 15010812, 16322295, 20126311, 20622016, 20635137, 21788678, 24464577, 25182704, 26400847, 26945445, 29083893, 30604896, 31627265, 7907978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17426702, 19075277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15511476, 20100636, 8988034		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20388850, 26617853, 29290818		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16595785, 29018805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12739007, 14585167, 15010812		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11956097, 14585167, 28295715, 29526253, 31083325, 9794242		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28780081		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17426702, 19075277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17426702, 19075277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17916906		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	7907978		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17426702, 19075277		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	9740247	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20388850, 20635137, 22294722, 28780081, 29083893		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37525498	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20388850, 26617853		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26617853, 34783299, 37522200, 37525498, 39809219	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16595785		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26465158		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12739007, 15010812		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11809769, 17229543, 38129809	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	14670177		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	14670177, 16354586	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21933890, 22005836, 24464577		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21933890, 22140552	Associate	★☆☆☆☆ Found in Text Mining only