Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2882
Gene name	Glutathione peroxidase 7
Gene symbol	GPX7
Synonyms (NCBI Gene)	CL683GPX6GPx-7GSHPx-7NPGPx
Chromosome	1
Chromosome location	1p32.3

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005045	hsa-let-7b-5p	Microarray	17699775
MIRT022803	hsa-miR-124-3p	Microarray	18668037
MIRT483610	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT483609	hsa-miR-6134	PAR-CLIP	23592263
MIRT483608	hsa-miR-1255a	PAR-CLIP	23592263
MIRT483607	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT483606	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT483605	hsa-miR-8071	PAR-CLIP	23592263
MIRT483604	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT483603	hsa-miR-3165	PAR-CLIP	23592263
MIRT483601	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT483610	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT483609	hsa-miR-6134	PAR-CLIP	23592263
MIRT483608	hsa-miR-1255a	PAR-CLIP	23592263
MIRT483607	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT483606	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT483605	hsa-miR-8071	PAR-CLIP	23592263
MIRT483604	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT483603	hsa-miR-3165	PAR-CLIP	23592263
MIRT483601	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT483610	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT483609	hsa-miR-6134	PAR-CLIP	23592263
MIRT483608	hsa-miR-1255a	PAR-CLIP	23592263
MIRT483607	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT483606	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT483605	hsa-miR-8071	PAR-CLIP	23592263
MIRT483604	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT483603	hsa-miR-3165	PAR-CLIP	23592263
MIRT483601	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT483610	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT483609	hsa-miR-6134	PAR-CLIP	23592263
MIRT483608	hsa-miR-1255a	PAR-CLIP	23592263
MIRT483607	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT483606	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT483605	hsa-miR-8071	PAR-CLIP	23592263
MIRT483604	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT483603	hsa-miR-3165	PAR-CLIP	23592263
MIRT483601	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT1032628	hsa-miR-139-3p	CLIP-seq
MIRT1032629	hsa-miR-3150b-3p	CLIP-seq
MIRT1032630	hsa-miR-4784	CLIP-seq
MIRT1032631	hsa-miR-765	CLIP-seq
MIRT2542723	hsa-let-7a	CLIP-seq
MIRT2542724	hsa-let-7b	CLIP-seq
MIRT2542725	hsa-let-7c	CLIP-seq
MIRT2542726	hsa-let-7d	CLIP-seq
MIRT2542727	hsa-let-7e	CLIP-seq
MIRT2542728	hsa-let-7f	CLIP-seq
MIRT2542729	hsa-let-7g	CLIP-seq
MIRT2542730	hsa-let-7i	CLIP-seq
MIRT2542731	hsa-miR-133a	CLIP-seq
MIRT2542732	hsa-miR-133b	CLIP-seq
MIRT2542733	hsa-miR-202	CLIP-seq
MIRT2542734	hsa-miR-27a	CLIP-seq
MIRT2542735	hsa-miR-27b	CLIP-seq
MIRT2542736	hsa-miR-3135	CLIP-seq
MIRT2542737	hsa-miR-3189-3p	CLIP-seq
MIRT2542738	hsa-miR-3622a-5p	CLIP-seq
MIRT2542739	hsa-miR-4281	CLIP-seq
MIRT2542740	hsa-miR-4423-3p	CLIP-seq
MIRT2542741	hsa-miR-4458	CLIP-seq
MIRT2542742	hsa-miR-4500	CLIP-seq
MIRT2542743	hsa-miR-4678	CLIP-seq
MIRT2542744	hsa-miR-4793-5p	CLIP-seq
MIRT2542745	hsa-miR-500a	CLIP-seq
MIRT2542746	hsa-miR-513a-5p	CLIP-seq
MIRT2542747	hsa-miR-98	CLIP-seq
MIRT2542723	hsa-let-7a	CLIP-seq
MIRT2542724	hsa-let-7b	CLIP-seq
MIRT2542725	hsa-let-7c	CLIP-seq
MIRT2542726	hsa-let-7d	CLIP-seq
MIRT2542727	hsa-let-7e	CLIP-seq
MIRT2542728	hsa-let-7f	CLIP-seq
MIRT2542729	hsa-let-7g	CLIP-seq
MIRT2542730	hsa-let-7i	CLIP-seq
MIRT2542731	hsa-miR-133a	CLIP-seq
MIRT2542732	hsa-miR-133b	CLIP-seq
MIRT2542733	hsa-miR-202	CLIP-seq
MIRT2542734	hsa-miR-27a	CLIP-seq
MIRT2542735	hsa-miR-27b	CLIP-seq
MIRT2542736	hsa-miR-3135	CLIP-seq
MIRT2542738	hsa-miR-3622a-5p	CLIP-seq
MIRT2542739	hsa-miR-4281	CLIP-seq
MIRT2542740	hsa-miR-4423-3p	CLIP-seq
MIRT2542741	hsa-miR-4458	CLIP-seq
MIRT2542742	hsa-miR-4500	CLIP-seq
MIRT2542743	hsa-miR-4678	CLIP-seq
MIRT2542744	hsa-miR-4793-5p	CLIP-seq
MIRT2542745	hsa-miR-500a	CLIP-seq
MIRT2542746	hsa-miR-513a-5p	CLIP-seq
MIRT2542747	hsa-miR-98	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004096	Function	Catalase activity	IDA	22157330
GO:0004601	Function	Peroxidase activity	EXP	21215271
GO:0004601	Function	Peroxidase activity	IBA
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	21215271
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
615784	4559	ENSG00000116157

Q96SL4

Protein name

Glutathione peroxidase 7 (GPx-7) (GSHPx-7) (EC 1.11.1.9) (CL683)

Protein function

It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxygen species (ROS) and protects against oxidative DNA damage and double-strand breaks. {ECO:0000269|PubMed:221573

PDB

2P31

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00255	GSHPx	25 → 133	Glutathione peroxidase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids. {ECO:0000269|PubMed:22157330}.

Sequence

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV
TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLI
LLKREDL

Sequence length

187

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolic pathways Thyroid hormone synthesis Amyotrophic lateral sclerosis Huntington disease Pathways of neurodegeneration - multiple diseases		Detoxification of Reactive Oxygen Species

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BARRETT ESOPHAGUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22157330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31747588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	18664505, 22157330, 24692067	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	22157330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	15294905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	18664505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24692067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26708178, 35286894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27322064, 36114673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40211130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35440701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39684755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25535386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30292945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36972403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15294905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28903346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15294905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29707965, 30984102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	25586538, 34674889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35143416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GPX7 (glutathione peroxidase 7)