GPX5 (glutathione peroxidase 5)

Gene

• Entrez ID: 2880
• Gene name: Glutathione peroxidase 5
• Gene symbol: GPX5
• Synonyms (NCBI Gene): EGLP, GPx-5, GSHPx-5, HEL-S-75p
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike several other characterized glutathione peroxidases, this enzyme is not a se

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1032587	hsa-miR-1286	CLIP-seq
MIRT1032588	hsa-miR-3190	CLIP-seq
MIRT1032589	hsa-miR-3202	CLIP-seq
MIRT1032590	hsa-miR-4299	CLIP-seq
MIRT1032591	hsa-miR-4446-5p	CLIP-seq
MIRT1032592	hsa-miR-4456	CLIP-seq
MIRT1032593	hsa-miR-4533	CLIP-seq
MIRT1032594	hsa-miR-4641	CLIP-seq
MIRT1032595	hsa-miR-4693-3p	CLIP-seq
MIRT1032596	hsa-miR-4722-5p	CLIP-seq
MIRT1032597	hsa-miR-4755-5p	CLIP-seq
MIRT1032598	hsa-miR-548q	CLIP-seq
MIRT1032599	hsa-miR-574-5p	CLIP-seq
MIRT1032600	hsa-miR-642a	CLIP-seq
MIRT2006319	hsa-miR-2278	CLIP-seq
MIRT2006320	hsa-miR-3614-3p	CLIP-seq
MIRT2006321	hsa-miR-4297	CLIP-seq
MIRT2006322	hsa-miR-587	CLIP-seq
MIRT2006323	hsa-miR-622	CLIP-seq
MIRT2238734	hsa-miR-1324	CLIP-seq
MIRT2238735	hsa-miR-3140-5p	CLIP-seq
MIRT2238736	hsa-miR-383	CLIP-seq
MIRT2238737	hsa-miR-4464	CLIP-seq
MIRT2238738	hsa-miR-4744	CLIP-seq
MIRT2238739	hsa-miR-4748	CLIP-seq
MIRT2238740	hsa-miR-490-3p	CLIP-seq
MIRT2238741	hsa-miR-649	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006629	Process	Lipid metabolic process	NAS	9639555
GO:0006979	Process	Response to oxidative stress	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 603435
• HGNC: 4557
• e!Ensembl: ENSG00000224586

Protein

• UniProt ID: O75715
• Protein name: Epididymal secretory glutathione peroxidase (EC 1.11.1.9) (Epididymis-specific glutathione peroxidase-like protein) (EGLP) (Glutathione peroxidase 5) (GPx-5) (GSHPx-5)
• Protein function: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage
• PDB: 2I3Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00255	GSHPx	40 → 153	Glutathione peroxidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Epididymis.
• Sequence:

  MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
  GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK
  YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR
  WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK

• Sequence length: 221

Pathways

KEGG:

Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Detoxification of Reactive Oxygen Species

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38393890	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30041175		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	25471206		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35143416	Associate	★☆☆☆☆ Found in Text Mining only