Gene Gene information from NCBI Gene database.
Entrez ID 2877
Gene name Glutathione peroxidase 2
Gene symbol GPX2
Synonyms (NCBI Gene)
GI-GPxGPRPGPRP-2GPx-2GPx-GIGSHPX-GIGSHPx-2
Chromosome 14
Chromosome location 14q23.3
Summary The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
miRNA miRNA information provided by mirtarbase database.
17
miRTarBase ID miRNA Experiments Reference
MIRT005746 hsa-miR-17-3p Luciferase reporter assayQuantitative proteomic approachWestern blot 21203553
MIRT018920 hsa-miR-335-5p Microarray 18185580
MIRT1032490 hsa-miR-1193 CLIP-seq
MIRT1032491 hsa-miR-1243 CLIP-seq
MIRT1032492 hsa-miR-1976 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity IBA
GO:0004602 Function Glutathione peroxidase activity IDA 8428933, 36608588
GO:0004602 Function Glutathione peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity TAS 8428933
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
138319 4554 ENSG00000176153
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18283
Protein name Glutathione peroxidase 2 (GPx-2) (GSHPx-2) (EC 1.11.1.9) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase-gastrointestinal) (GPx-GI) (GSHPx-GI) (Glutathione peroxidase-related protein 2) (GPRP-2) (Phospholipid hydroperoxide glutathione pe
Protein function Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:36608588, PubMed:8428933). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl h
PDB 2HE3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 8 120 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Mostly in liver and gastrointestinal tract, not found in heart or kidney. {ECO:0000269|PubMed:8428933}.
Sequence
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK

DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
Sequence length 190
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
  Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISM SPECTRUM DISORDER CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 28631563, 31695405
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 10965527
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 10965527, 15203372
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Barrett esophagus BEFREE 17277236
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 29662611
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 10498757, 18056462, 24278290, 31814764
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma CTD_human_DG 18056462
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 21940907, 28631563 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 18056462, 28635398
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28635398 Associate
★☆☆☆☆
Found in Text Mining only