GPX1 (glutathione peroxidase 1)

Gene

• Entrez ID: 2876
• Gene name: Glutathione peroxidase 1
• Gene symbol: GPX1
• Synonyms (NCBI Gene): GPXD, GSHPX1
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Other studies

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT040633	hsa-miR-92b-3p	CLASH	23622248
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT512629	hsa-miR-4259	PAR-CLIP	20371350
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	20371350
MIRT568884	hsa-miR-8060	PAR-CLIP	20371350
MIRT568883	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT512628	hsa-miR-4437	PAR-CLIP	20371350
MIRT512627	hsa-miR-3147	PAR-CLIP	20371350
MIRT512626	hsa-miR-4674	PAR-CLIP	20371350
MIRT512625	hsa-miR-1587	PAR-CLIP	20371350
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	20371350
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT512629	hsa-miR-4259	PAR-CLIP	23446348
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	23446348
MIRT512628	hsa-miR-4437	PAR-CLIP	23446348
MIRT512627	hsa-miR-3147	PAR-CLIP	23446348
MIRT512626	hsa-miR-4674	PAR-CLIP	23446348
MIRT512625	hsa-miR-1587	PAR-CLIP	23446348
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	23446348
MIRT486919	hsa-miR-634	PAR-CLIP	23592263
MIRT486918	hsa-miR-1226-3p	PAR-CLIP	23592263
MIRT486917	hsa-miR-4537	PAR-CLIP	23592263
MIRT486916	hsa-miR-505-5p	PAR-CLIP	23592263
MIRT486918	hsa-miR-1226-3p	PAR-CLIP	26701625
MIRT486917	hsa-miR-4537	PAR-CLIP	26701625
MIRT486916	hsa-miR-505-5p	PAR-CLIP	26701625
MIRT486919	hsa-miR-634	PAR-CLIP	26701625
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT512629	hsa-miR-4259	PAR-CLIP	20371350
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	20371350
MIRT568884	hsa-miR-8060	PAR-CLIP	20371350
MIRT568883	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT512628	hsa-miR-4437	PAR-CLIP	20371350
MIRT512627	hsa-miR-3147	PAR-CLIP	20371350
MIRT512626	hsa-miR-4674	PAR-CLIP	20371350
MIRT512625	hsa-miR-1587	PAR-CLIP	20371350
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	20371350
MIRT512631	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT512629	hsa-miR-4259	PAR-CLIP	23446348
MIRT512630	hsa-miR-4733-3p	PAR-CLIP	23446348
MIRT512628	hsa-miR-4437	PAR-CLIP	23446348
MIRT512627	hsa-miR-3147	PAR-CLIP	23446348
MIRT512626	hsa-miR-4674	PAR-CLIP	23446348
MIRT512625	hsa-miR-1587	PAR-CLIP	23446348
MIRT512624	hsa-miR-3620-5p	PAR-CLIP	23446348
MIRT486919	hsa-miR-634	PAR-CLIP	23592263
MIRT486918	hsa-miR-1226-3p	PAR-CLIP	23592263
MIRT486917	hsa-miR-4537	PAR-CLIP	23592263
MIRT486916	hsa-miR-505-5p	PAR-CLIP	23592263
MIRT1032472	hsa-miR-125a-3p	CLIP-seq
MIRT1032473	hsa-miR-3156-5p	CLIP-seq
MIRT1032474	hsa-miR-3607-3p	CLIP-seq
MIRT1032475	hsa-miR-3686	CLIP-seq
MIRT1032476	hsa-miR-3934	CLIP-seq
MIRT1032477	hsa-miR-4326	CLIP-seq
MIRT1032478	hsa-miR-4464	CLIP-seq
MIRT1032479	hsa-miR-4469	CLIP-seq
MIRT1032480	hsa-miR-4652-3p	CLIP-seq
MIRT1032481	hsa-miR-4655-3p	CLIP-seq
MIRT1032482	hsa-miR-4691-5p	CLIP-seq
MIRT1032483	hsa-miR-4748	CLIP-seq
MIRT1032484	hsa-miR-516a-5p	CLIP-seq
MIRT1032485	hsa-miR-764	CLIP-seq
MIRT1032486	hsa-miR-1290	CLIP-seq
MIRT1032487	hsa-miR-3157-3p	CLIP-seq
MIRT1032488	hsa-miR-4290	CLIP-seq
MIRT1032489	hsa-miR-874	CLIP-seq
MIRT1032472	hsa-miR-125a-3p	CLIP-seq
MIRT2238711	hsa-miR-1303	CLIP-seq
MIRT2238712	hsa-miR-214	CLIP-seq
MIRT2238713	hsa-miR-3125	CLIP-seq
MIRT1032473	hsa-miR-3156-5p	CLIP-seq
MIRT1032474	hsa-miR-3607-3p	CLIP-seq
MIRT2238714	hsa-miR-3619-5p	CLIP-seq
MIRT1032475	hsa-miR-3686	CLIP-seq
MIRT2238715	hsa-miR-3916	CLIP-seq
MIRT1032476	hsa-miR-3934	CLIP-seq
MIRT2238716	hsa-miR-4261	CLIP-seq
MIRT2238717	hsa-miR-4291	CLIP-seq
MIRT2238718	hsa-miR-4496	CLIP-seq
MIRT1032480	hsa-miR-4652-3p	CLIP-seq
MIRT2238719	hsa-miR-4772-5p	CLIP-seq
MIRT1032484	hsa-miR-516a-5p	CLIP-seq
MIRT2238720	hsa-miR-646	CLIP-seq
MIRT2238721	hsa-miR-761	CLIP-seq
MIRT1032485	hsa-miR-764	CLIP-seq
MIRT2238722	hsa-miR-877	CLIP-seq
MIRT2238723	hsa-miR-922	CLIP-seq
MIRT2388689	hsa-miR-2110	CLIP-seq
MIRT2388690	hsa-miR-3128	CLIP-seq
MIRT2388691	hsa-miR-421	CLIP-seq
MIRT2388692	hsa-miR-4271	CLIP-seq
MIRT2388693	hsa-miR-4460	CLIP-seq
MIRT2388694	hsa-miR-4463	CLIP-seq
MIRT2388695	hsa-miR-450b-3p	CLIP-seq
MIRT2388696	hsa-miR-4527	CLIP-seq
MIRT2388697	hsa-miR-4709-5p	CLIP-seq
MIRT2388698	hsa-miR-4713-3p	CLIP-seq
MIRT2388699	hsa-miR-4720-5p	CLIP-seq
MIRT2388700	hsa-miR-4725-3p	CLIP-seq
MIRT2388701	hsa-miR-4727-3p	CLIP-seq
MIRT2388702	hsa-miR-4799-3p	CLIP-seq
MIRT2388703	hsa-miR-491-5p	CLIP-seq
MIRT2388704	hsa-miR-638	CLIP-seq
MIRT2388705	hsa-miR-769-3p	CLIP-seq
MIRT2388706	hsa-miR-941	CLIP-seq
MIRT2388689	hsa-miR-2110	CLIP-seq
MIRT2542641	hsa-miR-3184	CLIP-seq
MIRT2542642	hsa-miR-423-5p	CLIP-seq
MIRT2542643	hsa-miR-4266	CLIP-seq
MIRT2388692	hsa-miR-4271	CLIP-seq
MIRT2388693	hsa-miR-4460	CLIP-seq
MIRT2542644	hsa-miR-4480	CLIP-seq
MIRT2542645	hsa-miR-4695-5p	CLIP-seq
MIRT2388700	hsa-miR-4725-3p	CLIP-seq
MIRT2388701	hsa-miR-4727-3p	CLIP-seq
MIRT2542646	hsa-miR-4779	CLIP-seq
MIRT2388703	hsa-miR-491-5p	CLIP-seq
MIRT2388706	hsa-miR-941	CLIP-seq
MIRT2388689	hsa-miR-2110	CLIP-seq
MIRT2388690	hsa-miR-3128	CLIP-seq
MIRT2542641	hsa-miR-3184	CLIP-seq
MIRT2542642	hsa-miR-423-5p	CLIP-seq
MIRT2542643	hsa-miR-4266	CLIP-seq
MIRT2388692	hsa-miR-4271	CLIP-seq
MIRT2388693	hsa-miR-4460	CLIP-seq
MIRT2388694	hsa-miR-4463	CLIP-seq
MIRT2542644	hsa-miR-4480	CLIP-seq
MIRT2388696	hsa-miR-4527	CLIP-seq
MIRT2542645	hsa-miR-4695-5p	CLIP-seq
MIRT2388699	hsa-miR-4720-5p	CLIP-seq
MIRT2388700	hsa-miR-4725-3p	CLIP-seq
MIRT2388701	hsa-miR-4727-3p	CLIP-seq
MIRT2542646	hsa-miR-4779	CLIP-seq
MIRT2388702	hsa-miR-4799-3p	CLIP-seq
MIRT2388703	hsa-miR-491-5p	CLIP-seq
MIRT2388706	hsa-miR-941	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TFAP2C	Activation	22964634

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001885	Process	Endothelial cell development	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	12829378, 12893824, 36608588
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32353859, 33060197, 35156780, 36012204, 36217030
GO:0005737	Component	Cytoplasm	IDA	10833429
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10833429
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	12829378
GO:0006915	Process	Apoptotic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009609	Process	Response to symbiotic bacterium	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009650	Process	UV protection	IMP	17097614
GO:0009725	Process	Response to hormone	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010269	Process	Response to selenium ion	IBA
GO:0010269	Process	Response to selenium ion	IEA
GO:0010269	Process	Response to selenium ion	IMP	12810669
GO:0010332	Process	Response to gamma radiation	IEA
GO:0014902	Process	Myotube differentiation	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0017124	Function	SH3 domain binding	IPI	12893824
GO:0019369	Process	Arachidonate metabolic process	IDA	11115402
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019372	Process	Lipoxygenase pathway	IDA	11115402
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0033599	Process	Regulation of mammary gland epithelial cell proliferation	IMP	16945136
GO:0034599	Process	Cellular response to oxidative stress	IDA	12893824
GO:0034599	Process	Cellular response to oxidative stress	NAS	18853169
GO:0035094	Process	Response to nicotine	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IDA	16132718
GO:0042311	Process	Vasodilation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IBA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042542	Process	Response to hydrogen peroxide	IMP	12829378
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	15203190
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045445	Process	Myoblast differentiation	IEA
GO:0045454	Process	Cell redox homeostasis	IDA	12829378
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IDA	11115402, 36608588
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051593	Process	Response to folic acid	IEA
GO:0051702	Process	Biological process involved in interaction with symbiont	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060047	Process	Heart contraction	IEA
GO:0060047	Process	Heart contraction	IMP	14573732
GO:0060055	Process	Angiogenesis involved in wound healing	IEA
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	12751788
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IMP	12221075
GO:0097413	Component	Lewy body	IDA	18853169
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	12221075
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902905	Process	Positive regulation of supramolecular fiber organization	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	12893824

Other IDs

• MIM: 138320
• HGNC: 4553
• e!Ensembl: ENSG00000233276

Protein

• UniProt ID: P07203
• Protein name: Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC 1.11.1.9) (Cellular glutathione peroxidase) (Phospholipid-hydroperoxide glutathione peroxidase GPX1) (EC 1.11.1.12)
• Protein function: Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:11115402, PubMed:36608588). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl
• PDB: 2F8A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00255	GSHPx	16 → 130	Glutathione peroxidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in platelets (at protein level). {ECO:0000269|PubMed:11115402}.
• Sequence:

  MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
  ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
  GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
  RRFQTIDIEPDIEALLSQGPSCA

• Sequence length: 203

Pathways

KEGG:

Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Detoxification of Reactive Oxygen Species
Purine catabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SICKLE CELL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLUTATHIONE PEROXIDASE DEFICIENCY, HEMOLYTIC ANEMIA POSSIBLY DUE TO	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gluthathione peroxidase deficiency	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GPX1 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GPX1-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHERMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTHER SPECIFIED IRON DEFICIENCY ANEMIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY HYPERTHYROIDISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	21062213		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12447480		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22371331		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40631607	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30958347		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	14648077		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	14648077		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	19951064	Inhibit	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29980787		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15331559, 19325139, 23874911, 23991041, 28467723		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19125369		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25882094	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15331559, 19325139, 23874911, 23991041, 28467723		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21852236	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34997988	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	19195803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	19195803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	34997988	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25894865		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	19499324		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	24852569		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	24852569	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15247771, 16230136, 19728855, 20441054, 21163569, 21586620, 21904836, 23975365, 24037914, 28145855, 28179340		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15247771		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	15247771		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	35361071	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21045266		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	12531513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	33085656	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	24039907		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12221075, 14744747, 16287877, 16945136, 20306294, 21045263, 22525041, 22964634, 24039907, 24278290, 26446998, 28587495, 29297700, 29411539, 29543921, 31814764, 7850813		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	12810669		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12221075, 16945136, 20003265, 21045263, 22964634, 24039907, 26446998, 28587495, 29411539, 29543921, 35215475	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18416831	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Head	Neoplasm of head	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15247771, 16230136, 19728855, 20441054, 21163569, 21586620, 21904836, 23975365, 24037914, 28145855, 28179340		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24074040, 27188866		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10657953, 14744747, 16797832, 17052796, 17548672, 18298806, 25866291, 8001233		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28884887	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30538220	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31844035	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28884887		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	18940188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	18940188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	18940188		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	14573732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18541150, 21087145, 22167619, 27010651, 27229152, 30394058		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27229152, 30394058, 36012132	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	Pubtator	29383971	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29383971	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	27302388		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22158110, 28961512		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29187474		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29187474		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26881045, 31340563		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26881045		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	30570876		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30668180		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	21975116		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21975116	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	20673159, 21907168		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18479189, 31765890		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28052094	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16317164		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16317164, 19428376, 25550558, 27823653		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290, 36299603	Associate	★☆☆☆☆ Found in Text Mining only
Compensated hemolytic anemia	Hemolytic anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	15184668, 18560803		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31844035		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12655278, 17825092, 18541150, 27067415, 27229152, 30225256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	12655278, 18541150, 21989715, 27067415, 27229152, 30225256		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17825092, 19033020, 27229152, 30225256	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27067415	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12655278, 18541150, 23906684, 27067415, 27229152, 30225256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	28052094		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31837702		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30286747		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	18853169		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23289525, 28958613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23289525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	21989715, 23874911, 26881045, 28961512, 29800654, 30394058		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33920886	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	12787913		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17275003, 19944066, 21185702, 21989715, 23874911, 26881045, 27925431, 28961512, 29800654, 30394058		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18541588, 30394058	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17825092, 27592002, 29383971	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26773925		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16123366, 23795780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17825092, 21989715, 22167619, 25283363, 26674569, 27592002, 29383971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	29383971	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23874911		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	16523188		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17179223		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15068240		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	20041472		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27010651		★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	15184668, 18560803		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35205233, 39794059	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36013572	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	19499324		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	28222320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	39849427	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	19499324		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28884887		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	22158110		★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	15184668, 18560803		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	10860543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	26897098		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26990426, 28781602		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	22016819		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	29243969		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	23748877		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	28547970	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	28547970	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19505917, 28494176, 33085656, 36838582, 37572455, 38182643	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23259684, 26124081		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23259684, 33085656	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	29693450		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	28039148		★☆☆☆☆ Found in Text Mining only
Glutathione Peroxidase Deficiency, Hemolytic Anemia possibly due to	Hemolytic Anemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gluthathione peroxidase deficiency	Gluthathione Peroxidase Deficiency	GENOMICS_ENGLAND_DG	1131421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	29454865		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28536671		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	15557674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	38147255	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	22877234	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	24517502		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	CTD_human_DG	15184668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	19944066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	23985558	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	15184668, 18560803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	BEFREE	19808019, 30703484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	21053180	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21053180, 27480094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	21593737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	CTD_human_DG	19914224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	31281590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	18541588	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy of tonsils	Hypertrophy Of Tonsils	BEFREE	22704671		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33174051	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37572455	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	15295091, 27302388		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	27930931		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28597397		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26355565, 29312611, 31765890		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28052094	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29180269, 33028732	Inhibit	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18541588, 30385096, 35806251	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	18479189, 19289149		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28198160		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	20178852, 24058403		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30524988		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	31576926	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	28174350		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31340563, 31382611	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26787049		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26881045, 31340563		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	31844035	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27188866, 28641905		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26823947, 34536536	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32808668	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16510607, 19929244, 20673159, 22512980, 26990426		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20673159, 21907168		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	16510607		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9792801		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23590304, 31801023		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10657953, 8001233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11103801		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16797832, 17052796, 18298806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18298806	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18298806, 19887610, 23516596, 28464886	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31844035	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16956821		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16956821		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16956821, 17149600, 22522002		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24967945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15557674, 16317164, 28536671		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12221075, 14744747, 16287877, 16945136, 20306294, 21045263, 22525041, 22964634, 24039907, 24278290, 26446998, 28587495, 29297700, 29411539, 29543921, 31814764, 7850813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	12810669		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31844035		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	23516596, 24074040, 27188866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10657953, 14744747, 16797832, 17052796, 17548672, 18298806, 25866291, 8001233		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11103801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29980787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12496980, 17548672, 18563616, 20477822, 21636625, 21993316, 22699881, 23046102, 23143801, 23363810, 23975365, 24437375, 24563517, 24711484, 30453672		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22843889, 27823653		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29371830		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15247771, 16230136, 19728855, 20441054, 21163569, 21586620, 21904836, 23975365, 24037914, 28145855, 28179340		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	15247771		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12496980, 15557674, 16317164, 18379781, 18563616, 19347979, 19826042, 20530237, 21045263, 21087145, 21636625, 21842217, 22371331, 23073788, 23975365, 24074040, 24395536, 25047527, 26446998, 26881045, 28087256, 28179349, 28739529, 29187474, 29374733, 29411539, 30394058, 30732891, 31844035, 9792801		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	15878749		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16317164		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	12810669		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12221075, 12810669, 16945136, 18267129		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	12810669		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	12810669		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29535818		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19505917		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	19505917	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23289525, 28958613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23289525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	26881045		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26881045, 28783735	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18541588	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18541588		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	11403514		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19254950	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23152058, 30385096	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	37400835	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27077777		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	19195504		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	11603647		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36447000	Inhibit	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10074919, 10657953, 10919671, 16317164, 19818074, 21842217, 21904836, 22371331, 22964634, 25550558, 28087256, 28536671, 28653098, 28884887, 29411539, 29543921		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	28174350		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	11403514		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12523938		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21240660, 26365964, 26897098		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31032363		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24597775, 26897098		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 4	Noonan syndrome	Pubtator	33070477	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	15184668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18541588, 21208780, 26545512	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	21208780, 31372751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	21240660		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	32378537	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30286747	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	18924182, 36926781	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	21045266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	31669348		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29980787		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30538220	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35062064	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	25666858		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	27796745		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	15824117		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18853169		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	39273702	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	25471206		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	28783735		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	28783735	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21975116		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21975116	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37390459	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21185702		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	27592002	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	21185702		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	15331559		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	LHGDN	15331559		★☆☆☆☆ Found in Text Mining only
Poikiloderma with Neutropenia	Poikiloderma With Neutropenia	BEFREE	28483637		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30206965, 31781040		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	30570876	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	26674569		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28958613		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	25439478	Associate	★☆☆☆☆ Found in Text Mining only
Primary Hyperthyroidism	Hyperthyroidism	CTD_human_DG	19914224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	12496980, 17548672, 18563616, 20477822, 21636625, 21993316, 22699881, 23046102, 23143801, 23363810, 23975365, 24437375, 24563517, 24711484, 30453672		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	23363810		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18806750		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23143801, 24437375, 24711484, 36295574	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24212762		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29506519	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	23590304		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31844035		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31844035		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30718447, 31747811		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15318035, 16413612, 19946932, 28872562		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	15318035		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12447480		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15878749, 28653098		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28904321, 39815613	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15878749, 28536671		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	10860543		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22843889, 27823653		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	30574618	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37862109	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35361071	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29966585		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29371830		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29371830		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31926619	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28052094		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	15557674		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36676755	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	LHGDN	17171548		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28673515	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	27100222		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	27100222		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	37107562	Associate	★☆☆☆☆ Found in Text Mining only