Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2873
Gene name	G protein pathway suppressor 1
Gene symbol	GPS1
Synonyms (NCBI Gene)	COPS1CSN1SGN1
Chromosome	17
Chromosome location	17q25.3
Summary	This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. [pro

162

Show/Hide all (162)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024116	hsa-let-7i-5p	Western blot	21530537
MIRT032090	hsa-let-7f-5p	Western blot	21530537
MIRT032096	hsa-let-7e-3p	Western blot	21530537
MIRT032191	hsa-let-7c-5p	Western blot	21530537
MIRT048796	hsa-miR-93-5p	CLASH	23622248
MIRT042663	hsa-miR-196b-5p	CLASH	23622248
MIRT042619	hsa-miR-423-3p	CLASH	23622248
MIRT496148	hsa-miR-1306-5p	PAR-CLIP	22291592
MIRT496147	hsa-miR-1224-3p	PAR-CLIP	22291592
MIRT496146	hsa-miR-4286	PAR-CLIP	22291592
MIRT496145	hsa-miR-1281	PAR-CLIP	22291592
MIRT496144	hsa-miR-668-5p	PAR-CLIP	22291592
MIRT496143	hsa-miR-566	PAR-CLIP	22291592
MIRT496148	hsa-miR-1306-5p	PAR-CLIP	22291592
MIRT496147	hsa-miR-1224-3p	PAR-CLIP	22291592
MIRT496146	hsa-miR-4286	PAR-CLIP	22291592
MIRT496145	hsa-miR-1281	PAR-CLIP	22291592
MIRT496144	hsa-miR-668-5p	PAR-CLIP	22291592
MIRT496143	hsa-miR-566	PAR-CLIP	22291592
MIRT1032329	hsa-miR-1231	CLIP-seq
MIRT1032330	hsa-miR-3130-3p	CLIP-seq
MIRT1032331	hsa-miR-3136-5p	CLIP-seq
MIRT1032332	hsa-miR-3197	CLIP-seq
MIRT1032333	hsa-miR-346	CLIP-seq
MIRT1032334	hsa-miR-3622a-3p	CLIP-seq
MIRT1032335	hsa-miR-3622b-3p	CLIP-seq
MIRT1032336	hsa-miR-4288	CLIP-seq
MIRT1032337	hsa-miR-4439	CLIP-seq
MIRT1032338	hsa-miR-4513	CLIP-seq
MIRT1032339	hsa-miR-4649-3p	CLIP-seq
MIRT1032340	hsa-miR-4793-3p	CLIP-seq
MIRT1032341	hsa-miR-627	CLIP-seq
MIRT1032342	hsa-miR-632	CLIP-seq
MIRT1032343	hsa-miR-767-3p	CLIP-seq
MIRT1032344	hsa-miR-924	CLIP-seq
MIRT1032345	hsa-miR-1227	CLIP-seq
MIRT1032346	hsa-miR-2964a-5p	CLIP-seq
MIRT1032347	hsa-miR-3153	CLIP-seq
MIRT1032348	hsa-miR-3192	CLIP-seq
MIRT1032332	hsa-miR-3197	CLIP-seq
MIRT1032349	hsa-miR-3612	CLIP-seq
MIRT1032350	hsa-miR-4252	CLIP-seq
MIRT1032351	hsa-miR-4292	CLIP-seq
MIRT1032352	hsa-miR-4308	CLIP-seq
MIRT1032353	hsa-miR-4314	CLIP-seq
MIRT1032354	hsa-miR-4443	CLIP-seq
MIRT1032355	hsa-miR-4459	CLIP-seq
MIRT1032356	hsa-miR-4646-5p	CLIP-seq
MIRT1032357	hsa-miR-4668-5p	CLIP-seq
MIRT1032358	hsa-miR-4779	CLIP-seq
MIRT1032359	hsa-miR-522	CLIP-seq
MIRT1032360	hsa-miR-622	CLIP-seq
MIRT1032361	hsa-miR-650	CLIP-seq
MIRT1032362	hsa-miR-661	CLIP-seq
MIRT1032343	hsa-miR-767-3p	CLIP-seq
MIRT1032363	hsa-miR-939	CLIP-seq
MIRT1032345	hsa-miR-1227	CLIP-seq
MIRT1032329	hsa-miR-1231	CLIP-seq
MIRT1032330	hsa-miR-3130-3p	CLIP-seq
MIRT1032331	hsa-miR-3136-5p	CLIP-seq
MIRT1032347	hsa-miR-3153	CLIP-seq
MIRT1032348	hsa-miR-3192	CLIP-seq
MIRT1032333	hsa-miR-346	CLIP-seq
MIRT1032334	hsa-miR-3622a-3p	CLIP-seq
MIRT1032335	hsa-miR-3622b-3p	CLIP-seq
MIRT1032336	hsa-miR-4288	CLIP-seq
MIRT1032353	hsa-miR-4314	CLIP-seq
MIRT1032337	hsa-miR-4439	CLIP-seq
MIRT1032338	hsa-miR-4513	CLIP-seq
MIRT1032356	hsa-miR-4646-5p	CLIP-seq
MIRT1032357	hsa-miR-4668-5p	CLIP-seq
MIRT1032340	hsa-miR-4793-3p	CLIP-seq
MIRT1032359	hsa-miR-522	CLIP-seq
MIRT1032342	hsa-miR-632	CLIP-seq
MIRT2542578	hsa-miR-1205	CLIP-seq
MIRT2542579	hsa-miR-1233	CLIP-seq
MIRT2542580	hsa-miR-1293	CLIP-seq
MIRT2542581	hsa-miR-1321	CLIP-seq
MIRT2542582	hsa-miR-15a	CLIP-seq
MIRT2542583	hsa-miR-15b	CLIP-seq
MIRT2542584	hsa-miR-16	CLIP-seq
MIRT2542585	hsa-miR-1915	CLIP-seq
MIRT2542586	hsa-miR-195	CLIP-seq
MIRT1032346	hsa-miR-2964a-5p	CLIP-seq
MIRT2542587	hsa-miR-3130-5p	CLIP-seq
MIRT2542588	hsa-miR-3173-5p	CLIP-seq
MIRT2542589	hsa-miR-3202	CLIP-seq
MIRT1032349	hsa-miR-3612	CLIP-seq
MIRT2542590	hsa-miR-3616-3p	CLIP-seq
MIRT2542591	hsa-miR-3667-3p	CLIP-seq
MIRT2542592	hsa-miR-3677-5p	CLIP-seq
MIRT2542593	hsa-miR-424	CLIP-seq
MIRT2542594	hsa-miR-4270	CLIP-seq
MIRT2542595	hsa-miR-4323	CLIP-seq
MIRT2542596	hsa-miR-4435	CLIP-seq
MIRT2542597	hsa-miR-4438	CLIP-seq
MIRT2542598	hsa-miR-4441	CLIP-seq
MIRT1032354	hsa-miR-4443	CLIP-seq
MIRT2542599	hsa-miR-4476	CLIP-seq
MIRT2542600	hsa-miR-4482	CLIP-seq
MIRT2542601	hsa-miR-4483	CLIP-seq
MIRT2542602	hsa-miR-4505	CLIP-seq
MIRT2542603	hsa-miR-4514	CLIP-seq
MIRT2542604	hsa-miR-4524	CLIP-seq
MIRT2542605	hsa-miR-4537	CLIP-seq
MIRT2542606	hsa-miR-4650-5p	CLIP-seq
MIRT2542607	hsa-miR-4690-3p	CLIP-seq
MIRT2542608	hsa-miR-4692	CLIP-seq
MIRT2542609	hsa-miR-4739	CLIP-seq
MIRT2542610	hsa-miR-4755-3p	CLIP-seq
MIRT2542611	hsa-miR-4756-5p	CLIP-seq
MIRT2542612	hsa-miR-4757-5p	CLIP-seq
MIRT2542613	hsa-miR-4763-5p	CLIP-seq
MIRT2542614	hsa-miR-497	CLIP-seq
MIRT2542615	hsa-miR-503	CLIP-seq
MIRT2542616	hsa-miR-646	CLIP-seq
MIRT1032361	hsa-miR-650	CLIP-seq
MIRT2542617	hsa-miR-665	CLIP-seq
MIRT1032363	hsa-miR-939	CLIP-seq
MIRT2542578	hsa-miR-1205	CLIP-seq
MIRT2542579	hsa-miR-1233	CLIP-seq
MIRT2542580	hsa-miR-1293	CLIP-seq
MIRT2542581	hsa-miR-1321	CLIP-seq
MIRT2542582	hsa-miR-15a	CLIP-seq
MIRT2542583	hsa-miR-15b	CLIP-seq
MIRT2542584	hsa-miR-16	CLIP-seq
MIRT2542585	hsa-miR-1915	CLIP-seq
MIRT2542586	hsa-miR-195	CLIP-seq
MIRT1032346	hsa-miR-2964a-5p	CLIP-seq
MIRT2542587	hsa-miR-3130-5p	CLIP-seq
MIRT2542588	hsa-miR-3173-5p	CLIP-seq
MIRT2542589	hsa-miR-3202	CLIP-seq
MIRT1032349	hsa-miR-3612	CLIP-seq
MIRT2542590	hsa-miR-3616-3p	CLIP-seq
MIRT2542591	hsa-miR-3667-3p	CLIP-seq
MIRT2542592	hsa-miR-3677-5p	CLIP-seq
MIRT2542593	hsa-miR-424	CLIP-seq
MIRT2542594	hsa-miR-4270	CLIP-seq
MIRT2542595	hsa-miR-4323	CLIP-seq
MIRT2542596	hsa-miR-4435	CLIP-seq
MIRT2542597	hsa-miR-4438	CLIP-seq
MIRT2542598	hsa-miR-4441	CLIP-seq
MIRT1032354	hsa-miR-4443	CLIP-seq
MIRT2542599	hsa-miR-4476	CLIP-seq
MIRT2542600	hsa-miR-4482	CLIP-seq
MIRT2542601	hsa-miR-4483	CLIP-seq
MIRT2542602	hsa-miR-4505	CLIP-seq
MIRT2542604	hsa-miR-4524	CLIP-seq
MIRT2542605	hsa-miR-4537	CLIP-seq
MIRT2542606	hsa-miR-4650-5p	CLIP-seq
MIRT2542607	hsa-miR-4690-3p	CLIP-seq
MIRT2542609	hsa-miR-4739	CLIP-seq
MIRT2542610	hsa-miR-4755-3p	CLIP-seq
MIRT2542611	hsa-miR-4756-5p	CLIP-seq
MIRT2542612	hsa-miR-4757-5p	CLIP-seq
MIRT2542613	hsa-miR-4763-5p	CLIP-seq
MIRT2542614	hsa-miR-497	CLIP-seq
MIRT2542615	hsa-miR-503	CLIP-seq
MIRT2542616	hsa-miR-646	CLIP-seq
MIRT1032361	hsa-miR-650	CLIP-seq
MIRT2542617	hsa-miR-665	CLIP-seq
MIRT1032363	hsa-miR-939	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000338	Process	Protein deneddylation	IDA	19141280
GO:0005095	Function	GTPase inhibitor activity	TAS	8943324
GO:0005515	Function	Protein binding	IPI	17337451, 18850735, 19444310, 19615732, 20399188, 21145461, 24421388, 25043011, 27029275, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	24421388
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24421388
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007254	Process	JNK cascade	TAS	8943324
GO:0008180	Component	COP9 signalosome	IBA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0008180	Component	COP9 signalosome	IEA
GO:0008180	Component	COP9 signalosome	IPI	25043011
GO:0008180	Component	COP9 signalosome	ISS
GO:0045116	Process	Protein neddylation	NAS	24421388
GO:2000434	Process	Regulation of protein neddylation	NAS	24421388

MIM	HGNC	e!Ensembl
601934	4549	ENSG00000169727

Q13098

Protein name

COP9 signalosome complex subunit 1 (SGN1) (Signalosome subunit 1) (G protein pathway suppressor 1) (GPS-1) (JAB1-containing signalosome subunit 1) (Protein MFH)

Protein function

Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of

PDB

4D10 , 4D18 , 4WSN , 6R6H , 6R7F , 6R7H , 6R7I , 6R7N , 8H38 , 8H3A , 8H3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10602	RPN7	127 → 309	26S proteasome subunit RPN7	Family
PF01399	PCI	324 → 428	PCI domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:8943324}.

Sequence

MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERL
QFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESG
VEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSN
ALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDS
QTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALAT
FDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAP
HVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSH
SKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTP
ANSQSRMSTNM

Sequence length

491

Interactions

View interactions

	Reactome
			DNA Damage Recognition in GG-NER Formation of TC-NER Pre-Incision Complex Cargo recognition for clathrin-mediated endocytosis Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	38289496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27325650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37705202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	28693167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	38289496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	27325650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	23518061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27325650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	27325650	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18678470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18678470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30442712		★★★★★ ★☆☆☆☆ Found in Text Mining only

GPS1 (G protein pathway suppressor 1)