TRARG1 (trafficking regulator of GLUT4 (SLC2A4) 1 (gene/pseudogene))

Gene

• Entrez ID: 286753
• Gene name: Trafficking regulator of GLUT4 (SLC2A4) 1 (gene/pseudogene)
• Gene symbol: TRARG1
• Synonyms (NCBI Gene): BEC-1, DSPB1, IFITMD3, LOST1, TUSC5
• Chromosome: 17
• Chromosome location: 17p13.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0044381	Process	Glucose import in response to insulin stimulus	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:0099500	Process	Vesicle fusion to plasma membrane	IEA
GO:0099638	Process	Endosome to plasma membrane protein transport	IEA
GO:0099638	Process	Endosome to plasma membrane protein transport	ISS

Other IDs

• MIM: 612211
• HGNC: 29592
• e!Ensembl: ENSG00000184811

Protein

• UniProt ID: Q8IXB3
• Protein name: Trafficking regulator of GLUT4 1 (Dispanin subfamily B member 1) (DSPB1) (Interferon-induced transmembrane domain-containing protein D3) (Protein located at seventeen-p-thirteen point three 1) (Tumor suppressor candidate 5)
• Protein function: Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged ins
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04505	CD225	100 → 167	Interferon-induced transmembrane protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the correspo
• Sequence:

  MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGL
  PFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLN
  LIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK

• Sequence length: 177

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	28560951		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28560951	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12660825		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31157375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28560951		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12660825		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31157375		★☆☆☆☆ Found in Text Mining only