Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2867
Gene name	Free fatty acid receptor 2
Gene symbol	FFAR2
Synonyms (NCBI Gene)	FFA2RGPR43
Chromosome	19
Chromosome location	19q13.12
Summary	This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulatin

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT661083	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT661081	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT661080	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT661079	hsa-miR-4532	HITS-CLIP	23824327
MIRT661078	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT661077	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT661076	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT661075	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT661083	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT661081	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT661080	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT661079	hsa-miR-4532	HITS-CLIP	23824327
MIRT661078	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT661077	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT661076	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT661075	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT995060	hsa-miR-1265	CLIP-seq
MIRT995061	hsa-miR-2117	CLIP-seq
MIRT995062	hsa-miR-4273	CLIP-seq
MIRT995063	hsa-miR-4446-5p	CLIP-seq
MIRT995064	hsa-miR-4716-5p	CLIP-seq
MIRT995065	hsa-miR-941	CLIP-seq
MIRT1995056	hsa-miR-122	CLIP-seq
MIRT1995057	hsa-miR-1227	CLIP-seq
MIRT1995058	hsa-miR-1909	CLIP-seq
MIRT1995059	hsa-miR-3135b	CLIP-seq
MIRT1995060	hsa-miR-3652	CLIP-seq
MIRT1995061	hsa-miR-3929	CLIP-seq
MIRT1995062	hsa-miR-4268	CLIP-seq
MIRT1995063	hsa-miR-4419b	CLIP-seq
MIRT1995064	hsa-miR-4430	CLIP-seq
MIRT1995065	hsa-miR-4448	CLIP-seq
MIRT1995066	hsa-miR-4478	CLIP-seq
MIRT1995067	hsa-miR-4524	CLIP-seq
MIRT1995068	hsa-miR-455-5p	CLIP-seq
MIRT1995069	hsa-miR-4690-5p	CLIP-seq
MIRT1995070	hsa-miR-4715-3p	CLIP-seq
MIRT1995071	hsa-miR-520a-5p	CLIP-seq
MIRT1995072	hsa-miR-525-5p	CLIP-seq
MIRT1995073	hsa-miR-645	CLIP-seq
MIRT1995056	hsa-miR-122	CLIP-seq
MIRT2229141	hsa-miR-1245	CLIP-seq
MIRT1995059	hsa-miR-3135b	CLIP-seq
MIRT1995060	hsa-miR-3652	CLIP-seq
MIRT1995061	hsa-miR-3929	CLIP-seq
MIRT1995063	hsa-miR-4419b	CLIP-seq
MIRT1995064	hsa-miR-4430	CLIP-seq
MIRT1995066	hsa-miR-4478	CLIP-seq
MIRT2229142	hsa-miR-640	CLIP-seq
MIRT1995073	hsa-miR-645	CLIP-seq
MIRT995065	hsa-miR-941	CLIP-seq
MIRT1995056	hsa-miR-122	CLIP-seq
MIRT1995059	hsa-miR-3135b	CLIP-seq
MIRT2387977	hsa-miR-3169	CLIP-seq
MIRT1995060	hsa-miR-3652	CLIP-seq
MIRT1995061	hsa-miR-3929	CLIP-seq
MIRT1995063	hsa-miR-4419b	CLIP-seq
MIRT1995064	hsa-miR-4430	CLIP-seq
MIRT1995066	hsa-miR-4478	CLIP-seq
MIRT1995073	hsa-miR-645	CLIP-seq
MIRT2428894	hsa-miR-522	CLIP-seq
MIRT2449631	hsa-miR-1193	CLIP-seq
MIRT2449632	hsa-miR-129-5p	CLIP-seq
MIRT2449633	hsa-miR-150	CLIP-seq
MIRT2449634	hsa-miR-1915	CLIP-seq
MIRT2449635	hsa-miR-3149	CLIP-seq
MIRT2449636	hsa-miR-3167	CLIP-seq
MIRT2449637	hsa-miR-411	CLIP-seq
MIRT2449638	hsa-miR-4300	CLIP-seq
MIRT2449639	hsa-miR-4427	CLIP-seq
MIRT2449640	hsa-miR-4680-3p	CLIP-seq
MIRT2449641	hsa-miR-4713-5p	CLIP-seq
MIRT1995070	hsa-miR-4715-3p	CLIP-seq
MIRT2449642	hsa-miR-4726-3p	CLIP-seq
MIRT2449643	hsa-miR-4735-5p	CLIP-seq
MIRT2449644	hsa-miR-4762-3p	CLIP-seq
MIRT2449645	hsa-miR-4775	CLIP-seq
MIRT2449646	hsa-miR-4782-5p	CLIP-seq
MIRT2449647	hsa-miR-483-5p	CLIP-seq
MIRT2449648	hsa-miR-532-3p	CLIP-seq
MIRT2449649	hsa-miR-590-3p	CLIP-seq
MIRT2449650	hsa-miR-876-5p	CLIP-seq
MIRT2449651	hsa-miR-920	CLIP-seq
MIRT2449632	hsa-miR-129-5p	CLIP-seq
MIRT2449635	hsa-miR-3149	CLIP-seq
MIRT2449637	hsa-miR-411	CLIP-seq
MIRT1995070	hsa-miR-4715-3p	CLIP-seq
MIRT2449643	hsa-miR-4735-5p	CLIP-seq
MIRT2449645	hsa-miR-4775	CLIP-seq
MIRT2449647	hsa-miR-483-5p	CLIP-seq
MIRT2449649	hsa-miR-590-3p	CLIP-seq
MIRT1995056	hsa-miR-122	CLIP-seq
MIRT1995057	hsa-miR-1227	CLIP-seq
MIRT2449632	hsa-miR-129-5p	CLIP-seq
MIRT1995059	hsa-miR-3135b	CLIP-seq
MIRT2449635	hsa-miR-3149	CLIP-seq
MIRT1995060	hsa-miR-3652	CLIP-seq
MIRT1995061	hsa-miR-3929	CLIP-seq
MIRT2449637	hsa-miR-411	CLIP-seq
MIRT1995063	hsa-miR-4419b	CLIP-seq
MIRT1995064	hsa-miR-4430	CLIP-seq
MIRT1995066	hsa-miR-4478	CLIP-seq
MIRT1995068	hsa-miR-455-5p	CLIP-seq
MIRT1995070	hsa-miR-4715-3p	CLIP-seq
MIRT2449643	hsa-miR-4735-5p	CLIP-seq
MIRT2449645	hsa-miR-4775	CLIP-seq
MIRT2449647	hsa-miR-483-5p	CLIP-seq
MIRT2449649	hsa-miR-590-3p	CLIP-seq
MIRT1995073	hsa-miR-645	CLIP-seq
MIRT1995056	hsa-miR-122	CLIP-seq
MIRT1995057	hsa-miR-1227	CLIP-seq
MIRT2449632	hsa-miR-129-5p	CLIP-seq
MIRT1995059	hsa-miR-3135b	CLIP-seq
MIRT2449635	hsa-miR-3149	CLIP-seq
MIRT1995060	hsa-miR-3652	CLIP-seq
MIRT1995061	hsa-miR-3929	CLIP-seq
MIRT2449637	hsa-miR-411	CLIP-seq
MIRT1995063	hsa-miR-4419b	CLIP-seq
MIRT1995064	hsa-miR-4430	CLIP-seq
MIRT1995066	hsa-miR-4478	CLIP-seq
MIRT1995068	hsa-miR-455-5p	CLIP-seq
MIRT1995070	hsa-miR-4715-3p	CLIP-seq
MIRT2449643	hsa-miR-4735-5p	CLIP-seq
MIRT2449645	hsa-miR-4775	CLIP-seq
MIRT2449647	hsa-miR-483-5p	CLIP-seq
MIRT2449649	hsa-miR-590-3p	CLIP-seq
MIRT1995073	hsa-miR-645	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002385	Process	Mucosal immune response	IEA
GO:0002385	Process	Mucosal immune response	ISS
GO:0002673	Process	Regulation of acute inflammatory response	IEA
GO:0002673	Process	Regulation of acute inflammatory response	ISS
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	ISS
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IMP	21037097
GO:0002879	Process	Positive regulation of acute inflammatory response to non-antigenic stimulus	IEA
GO:0002879	Process	Positive regulation of acute inflammatory response to non-antigenic stimulus	ISS
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	12496283, 18801738, 23589301
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	21037097, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18801738, 21037097
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9344866
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12496283, 18801738, 23589301
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0019915	Process	Lipid storage	IEA
GO:0019915	Process	Lipid storage	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	21037097
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0071398	Process	Cellular response to fatty acid	IBA
GO:0071398	Process	Cellular response to fatty acid	IDA	12496283, 18801738, 23589301
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0090276	Process	Regulation of peptide hormone secretion	IEA
GO:0090276	Process	Regulation of peptide hormone secretion	ISS
GO:1990806	Process	Ligand-gated ion channel signaling pathway	IEA

MIM	HGNC	e!Ensembl
603823	4501	ENSG00000126262

O15552

Protein name

Free fatty acid receptor 2 (G-protein coupled receptor 43)

Protein function

G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous m

PDB

8J22 , 8J23 , 8J24 , 8T3S , 9K1D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	24 → 273	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at relatively high levels in peripheral blood leukocytes and, to lesser extent, in spleen. {ECO:0000269|PubMed:12496283, ECO:0000269|PubMed:12684041}.

Sequence

MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLL
LLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLS
RRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVR
LELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNV
SHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLG
RRGKDTAEGTNEDRGVGQGEGMPSSDFTTE

Sequence length

330

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway		G alpha (q) signalling events Free fatty acid receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
APPENDICITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF APPENDIX	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (46)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	20979106, 29524208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29524208, 31734354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28075383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28075383, 28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29049318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23852543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23828891, 26742586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35543875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20979106, 29524208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29049318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26140540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28212864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30203438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30203438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30190473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25298143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28784695, 30190473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28049222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35731142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30201970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	26742586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36601116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28727837, 29988393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31211831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28212864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30190473	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28526687		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28873082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36129940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30140374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29644622, 30836015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20979106, 29524208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23852543, 30247908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20979106, 30836015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29353414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23852543, 26023106, 30459320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31100533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30209581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32121422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31250637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31059977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37370057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FFAR2 (free fatty acid receptor 2)