Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2865
Gene name	Free fatty acid receptor 3
Gene symbol	FFAR3
Synonyms (NCBI Gene)	FFA3RGPR41GPR42
Chromosome	19
Chromosome location	19q13.12

Show/Hide all (38)

miRTarBase ID	miRNA	Experiments
MIRT995066	hsa-miR-1185	CLIP-seq
MIRT995067	hsa-miR-1285	CLIP-seq
MIRT995068	hsa-miR-3064-5p	CLIP-seq
MIRT995069	hsa-miR-3187-5p	CLIP-seq
MIRT995070	hsa-miR-3192	CLIP-seq
MIRT995071	hsa-miR-3605-5p	CLIP-seq
MIRT995072	hsa-miR-3652	CLIP-seq
MIRT995073	hsa-miR-3679-5p	CLIP-seq
MIRT995074	hsa-miR-3921	CLIP-seq
MIRT995075	hsa-miR-4268	CLIP-seq
MIRT995076	hsa-miR-4292	CLIP-seq
MIRT995077	hsa-miR-4300	CLIP-seq
MIRT995078	hsa-miR-4430	CLIP-seq
MIRT995079	hsa-miR-4505	CLIP-seq
MIRT995080	hsa-miR-4649-3p	CLIP-seq
MIRT995081	hsa-miR-4653-5p	CLIP-seq
MIRT995082	hsa-miR-4660	CLIP-seq
MIRT995083	hsa-miR-612	CLIP-seq
MIRT995084	hsa-miR-646	CLIP-seq
MIRT995085	hsa-miR-720	CLIP-seq
MIRT995086	hsa-miR-920	CLIP-seq
MIRT995075	hsa-miR-4268	CLIP-seq
MIRT1995074	hsa-miR-4715-3p	CLIP-seq
MIRT1995075	hsa-miR-4727-5p	CLIP-seq
MIRT1995076	hsa-miR-4769-3p	CLIP-seq
MIRT2229143	hsa-miR-1206	CLIP-seq
MIRT995067	hsa-miR-1285	CLIP-seq
MIRT2229144	hsa-miR-1470	CLIP-seq
MIRT2229145	hsa-miR-2114	CLIP-seq
MIRT995069	hsa-miR-3187-5p	CLIP-seq
MIRT2229146	hsa-miR-3680	CLIP-seq
MIRT2229147	hsa-miR-3691-3p	CLIP-seq
MIRT2229148	hsa-miR-3943	CLIP-seq
MIRT2229149	hsa-miR-4289	CLIP-seq
MIRT2229150	hsa-miR-4313	CLIP-seq
MIRT2229151	hsa-miR-4667-3p	CLIP-seq
MIRT1995074	hsa-miR-4715-3p	CLIP-seq
MIRT995083	hsa-miR-612	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002385	Process	Mucosal immune response	ISS
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	ISS
GO:0002879	Process	Positive regulation of acute inflammatory response to non-antigenic stimulus	ISS
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	12496283, 14722361, 18801738
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18801738
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9344866
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12496283, 18801738
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	14722361
GO:0008289	Function	Lipid binding	IEA
GO:0014061	Process	Regulation of norepinephrine secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0046626	Process	Regulation of insulin receptor signaling pathway	ISS
GO:0046885	Process	Regulation of hormone biosynthetic process	ISS
GO:0071398	Process	Cellular response to fatty acid	IBA
GO:0071398	Process	Cellular response to fatty acid	IDA	12496283, 14722361, 18801738
GO:0090276	Process	Regulation of peptide hormone secretion	ISS

MIM	HGNC	e!Ensembl
603821	4499	ENSG00000185897

O14843

Protein name

Free fatty acid receptor 3 (G-protein coupled receptor 41)

Protein function

G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous m

PDB

8J20 , 8J21

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	31 → 276	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highest level in adipose tissue, and lower expression across all tissues tested. Expressed in sympathetic ganglia. {ECO:0000269|PubMed:12496283, ECO:0000269|PubMed:21518883}.

Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTAS
DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP
LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAI
LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGP
YNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ
WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

Sequence length

346

Interactions

View interactions

	Reactome
			G alpha (q) signalling events Free fatty acid receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28075383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28075383, 28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29049318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29049318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26266556	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24325907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	30958799, 31703761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30958801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30140374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24325907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28883043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37370057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FFAR3 (free fatty acid receptor 3)