Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Other IDs Protein Associated diseases
Entrez ID	286319
Gene name	Tumor suppressor candidate 1
Gene symbol	TUSC1
Synonyms (NCBI Gene)	CCDC89BTSG-9TSG9
Chromosome	9
Chromosome location	9p21.2
Summary	This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it

132

Show/Hide all (132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025062	hsa-miR-181a-5p	Microarray	17612493
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT504318	hsa-miR-3148	PAR-CLIP	21572407
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT504318	hsa-miR-3148	PAR-CLIP	21572407
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT504318	hsa-miR-3148	PAR-CLIP	21572407
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT735840	hsa-miR-3934-3p	qRT-PCR	32765063
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT504318	hsa-miR-3148	PAR-CLIP	20371350
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT504318	hsa-miR-3148	PAR-CLIP	21572407
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT504318	hsa-miR-3148	PAR-CLIP	21572407
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT504318	hsa-miR-3148	PAR-CLIP	21572407
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT504320	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT504319	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT504318	hsa-miR-3148	PAR-CLIP	23446348
MIRT504317	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT1464092	hsa-miR-1227	CLIP-seq
MIRT1464093	hsa-miR-129-5p	CLIP-seq
MIRT1464094	hsa-miR-203	CLIP-seq
MIRT1464095	hsa-miR-2113	CLIP-seq
MIRT1464096	hsa-miR-3127-5p	CLIP-seq
MIRT1464097	hsa-miR-3616-5p	CLIP-seq
MIRT1464098	hsa-miR-3647-5p	CLIP-seq
MIRT1464099	hsa-miR-4270	CLIP-seq
MIRT1464100	hsa-miR-4441	CLIP-seq
MIRT1464101	hsa-miR-4517	CLIP-seq
MIRT1464102	hsa-miR-4795-5p	CLIP-seq
MIRT1464103	hsa-miR-573	CLIP-seq
MIRT1557239	hsa-miR-3591-3p	CLIP-seq
MIRT1557240	hsa-miR-3691-3p	CLIP-seq
MIRT1557241	hsa-miR-802	CLIP-seq
MIRT2139604	hsa-miR-1245b-5p	CLIP-seq
MIRT2139605	hsa-miR-31	CLIP-seq
MIRT2139606	hsa-miR-3142	CLIP-seq
MIRT2139607	hsa-miR-3183	CLIP-seq
MIRT2139608	hsa-miR-3925-3p	CLIP-seq
MIRT2139609	hsa-miR-3926	CLIP-seq
MIRT2139610	hsa-miR-4685-5p	CLIP-seq
MIRT2139611	hsa-miR-4723-3p	CLIP-seq
MIRT2139612	hsa-miR-4757-5p	CLIP-seq
MIRT2139613	hsa-miR-4800-3p	CLIP-seq
MIRT2139614	hsa-miR-548s	CLIP-seq
MIRT2139615	hsa-miR-766	CLIP-seq
MIRT2360211	hsa-miR-1207-5p	CLIP-seq
MIRT2360212	hsa-miR-340	CLIP-seq
MIRT2360213	hsa-miR-4471	CLIP-seq
MIRT2139610	hsa-miR-4685-5p	CLIP-seq
MIRT2360214	hsa-miR-4763-3p	CLIP-seq

MIM	HGNC	e!Ensembl
610529	31010	ENSG00000198680

Q2TAM9

Protein name

Tumor suppressor candidate gene 1 protein (TSG-9) (TSG9)

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low level. Expressed at higher level in testis, weakly expressed in muscle, colon, lung and spleen. Not detected in 3 non small cell lung carcinoma (NSCLC) cell lines with homozygous deletion of the 9p region, while

Sequence

MGPMWRMRGGATRRGSCCGGDGAADGRGPGRSGRARGGGSPSGGGGGVGWRGRADGARQQ
LEERFADLAASHLEAIRARDEWDRQNARLRQENARLRLENRRLKRENRSLFRQALRLPGE
GGNGTPAEARRVPEEASTNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQR
GPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL

Sequence length

212

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Azoospermia	Azoospermia	BEFREE	28975488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	28975488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25239644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35655316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25239644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15208665, 23776618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26897357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26897357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	28975488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24366000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15208665, 23776618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24700496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25239644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23776618, 24366000, 26897357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	28975488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25239644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24700496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25239644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TUSC1 (tumor suppressor candidate 1)