Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2863
Gene name	G protein-coupled receptor 39
Gene symbol	GPR39
Synonyms (NCBI Gene)	ZnR
Chromosome	2
Chromosome location	2q21.2
Summary	This gene is a member of the ghrelin receptor family and encodes a rhodopsin-type G-protein-coupled receptor (GPCR). The encoded protein is involved in zinc-dependent signaling in epithelial tissue in intestines, prostate and salivary glands. The protein

110

Show/Hide all (110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029962	hsa-miR-26b-5p	Microarray	19088304
MIRT736805	hsa-miR-1914-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)	31576658
MIRT1031367	hsa-miR-1252	CLIP-seq
MIRT1031368	hsa-miR-1260	CLIP-seq
MIRT1031369	hsa-miR-1260b	CLIP-seq
MIRT1031370	hsa-miR-1296	CLIP-seq
MIRT1031371	hsa-miR-188-3p	CLIP-seq
MIRT1031372	hsa-miR-1914	CLIP-seq
MIRT1031373	hsa-miR-1976	CLIP-seq
MIRT1031374	hsa-miR-19a	CLIP-seq
MIRT1031375	hsa-miR-19b	CLIP-seq
MIRT1031376	hsa-miR-2116	CLIP-seq
MIRT1031377	hsa-miR-2117	CLIP-seq
MIRT1031378	hsa-miR-2909	CLIP-seq
MIRT1031379	hsa-miR-3135b	CLIP-seq
MIRT1031380	hsa-miR-3156-3p	CLIP-seq
MIRT1031381	hsa-miR-3158-3p	CLIP-seq
MIRT1031382	hsa-miR-3173-3p	CLIP-seq
MIRT1031383	hsa-miR-33a	CLIP-seq
MIRT1031384	hsa-miR-33b	CLIP-seq
MIRT1031385	hsa-miR-3652	CLIP-seq
MIRT1031386	hsa-miR-3689d	CLIP-seq
MIRT1031387	hsa-miR-375	CLIP-seq
MIRT1031388	hsa-miR-3922-5p	CLIP-seq
MIRT1031389	hsa-miR-4273	CLIP-seq
MIRT1031390	hsa-miR-4301	CLIP-seq
MIRT1031391	hsa-miR-4326	CLIP-seq
MIRT1031392	hsa-miR-4430	CLIP-seq
MIRT1031393	hsa-miR-4446-3p	CLIP-seq
MIRT1031394	hsa-miR-4476	CLIP-seq
MIRT1031395	hsa-miR-4477a	CLIP-seq
MIRT1031396	hsa-miR-4492	CLIP-seq
MIRT1031397	hsa-miR-4498	CLIP-seq
MIRT1031398	hsa-miR-4533	CLIP-seq
MIRT1031399	hsa-miR-4635	CLIP-seq
MIRT1031400	hsa-miR-4640-3p	CLIP-seq
MIRT1031401	hsa-miR-4640-5p	CLIP-seq
MIRT1031402	hsa-miR-4667-3p	CLIP-seq
MIRT1031403	hsa-miR-4677-5p	CLIP-seq
MIRT1031404	hsa-miR-4715-3p	CLIP-seq
MIRT1031405	hsa-miR-4726-5p	CLIP-seq
MIRT1031406	hsa-miR-4753-3p	CLIP-seq
MIRT1031407	hsa-miR-762	CLIP-seq
MIRT2005963	hsa-miR-1224-3p	CLIP-seq
MIRT2005964	hsa-miR-125a-5p	CLIP-seq
MIRT2005965	hsa-miR-125b	CLIP-seq
MIRT1031368	hsa-miR-1260	CLIP-seq
MIRT1031369	hsa-miR-1260b	CLIP-seq
MIRT1031370	hsa-miR-1296	CLIP-seq
MIRT1031371	hsa-miR-188-3p	CLIP-seq
MIRT1031378	hsa-miR-2909	CLIP-seq
MIRT1031379	hsa-miR-3135b	CLIP-seq
MIRT1031380	hsa-miR-3156-3p	CLIP-seq
MIRT1031381	hsa-miR-3158-3p	CLIP-seq
MIRT2005966	hsa-miR-3174	CLIP-seq
MIRT1031385	hsa-miR-3652	CLIP-seq
MIRT1031388	hsa-miR-3922-5p	CLIP-seq
MIRT1031390	hsa-miR-4301	CLIP-seq
MIRT2005967	hsa-miR-4319	CLIP-seq
MIRT1031392	hsa-miR-4430	CLIP-seq
MIRT1031393	hsa-miR-4446-3p	CLIP-seq
MIRT1031396	hsa-miR-4492	CLIP-seq
MIRT1031397	hsa-miR-4498	CLIP-seq
MIRT1031401	hsa-miR-4640-5p	CLIP-seq
MIRT1031405	hsa-miR-4726-5p	CLIP-seq
MIRT2005968	hsa-miR-4732-3p	CLIP-seq
MIRT2005969	hsa-miR-4753-5p	CLIP-seq
MIRT2005970	hsa-miR-4755-3p	CLIP-seq
MIRT2005971	hsa-miR-4765	CLIP-seq
MIRT2005972	hsa-miR-654-3p	CLIP-seq
MIRT2005973	hsa-miR-670	CLIP-seq
MIRT1031407	hsa-miR-762	CLIP-seq
MIRT2238526	hsa-miR-122	CLIP-seq
MIRT1031367	hsa-miR-1252	CLIP-seq
MIRT2238527	hsa-miR-2053	CLIP-seq
MIRT2238528	hsa-miR-3129-3p	CLIP-seq
MIRT2238529	hsa-miR-3140-3p	CLIP-seq
MIRT2238530	hsa-miR-3672	CLIP-seq
MIRT2238531	hsa-miR-3945	CLIP-seq
MIRT2238532	hsa-miR-4315	CLIP-seq
MIRT2238533	hsa-miR-4328	CLIP-seq
MIRT2238534	hsa-miR-4790-5p	CLIP-seq
MIRT2238535	hsa-miR-548a-3p	CLIP-seq
MIRT2238536	hsa-miR-548e	CLIP-seq
MIRT2238537	hsa-miR-548f	CLIP-seq
MIRT2005972	hsa-miR-654-3p	CLIP-seq
MIRT2005963	hsa-miR-1224-3p	CLIP-seq
MIRT1031373	hsa-miR-1976	CLIP-seq
MIRT1031376	hsa-miR-2116	CLIP-seq
MIRT1031383	hsa-miR-33a	CLIP-seq
MIRT1031384	hsa-miR-33b	CLIP-seq
MIRT1031389	hsa-miR-4273	CLIP-seq
MIRT2450627	hsa-miR-4314	CLIP-seq
MIRT1031400	hsa-miR-4640-3p	CLIP-seq
MIRT1031402	hsa-miR-4667-3p	CLIP-seq
MIRT1031403	hsa-miR-4677-5p	CLIP-seq
MIRT2450628	hsa-miR-4687-5p	CLIP-seq
MIRT1031404	hsa-miR-4715-3p	CLIP-seq
MIRT2005963	hsa-miR-1224-3p	CLIP-seq
MIRT1031373	hsa-miR-1976	CLIP-seq
MIRT1031376	hsa-miR-2116	CLIP-seq
MIRT1031383	hsa-miR-33a	CLIP-seq
MIRT1031384	hsa-miR-33b	CLIP-seq
MIRT1031389	hsa-miR-4273	CLIP-seq
MIRT2450627	hsa-miR-4314	CLIP-seq
MIRT1031400	hsa-miR-4640-3p	CLIP-seq
MIRT1031402	hsa-miR-4667-3p	CLIP-seq
MIRT1031403	hsa-miR-4677-5p	CLIP-seq
MIRT2450628	hsa-miR-4687-5p	CLIP-seq
MIRT1031404	hsa-miR-4715-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HNF1A	Unknown	17488974
HNF4A	Unknown	17488974
SP1	Unknown	17488974

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9441746
GO:0005515	Function	Protein binding	IPI	26365466
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9441746
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9441746
GO:0016020	Component	Membrane	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602886	4496	ENSG00000183840

O43194

Protein name

G-protein coupled receptor 39

Protein function

Zinc-sensing receptor that can sense changes in extracellular Zn(2+), mediate Zn(2+) signal transmission, and participates in the regulation of numerous physiological processes including glucose homeostasis regulation, gastrointestinal mobility,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	47 → 344	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues, including the stomach, intestine and hypothalamus. {ECO:0000269|PubMed:9441746}.

Sequence

MASPSLPGSDCSQIIDHSHVPEFEVATWIKITLILVYLIIFVMGLLGNSATIRVTQVLQK
KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTSSYTLSCKLHTFLFEACSY
ATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPL
VNVPSHRGLTCNRSSTRHHEQPETSNMSICTNLSSRWTVFQSSIFGAFVVYLVVLLSVAF
MCWNMMQVLMKSQKGSLAGGTRPPQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQ
IRRIMAAAKPKHDWTRSYFRAYMILLPFSETFFYLSSVINPLLYTVSSQQFRRVFVQVLC
CRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQ
SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV

Sequence length

453

Interactions

View interactions

	Reactome
			Class A/1 (Rhodopsin-like receptors) G alpha (q) signalling events G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26716511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26716511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31202806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31202806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31167986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29802348, 31146164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29802348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37839873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31237151, 31678046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31272355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30419533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30738010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30738010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17371481	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17371481, 27106635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21352519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21352519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26716511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32784555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21626137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASDB_DG	21626137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31576658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37839873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29802348, 31146164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21352519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29389900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30419533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	31842742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21352519, 26716511, 29802348, 31146164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17371481	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27106635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29976977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31237151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31448639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31272355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29389900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31539553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21352519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26716511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	19696931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GPR39 (G protein-coupled receptor 39)