SCARA5 (scavenger receptor class A member 5)

Gene

• Entrez ID: 286133
• Gene name: Scavenger receptor class A member 5
• Gene symbol: SCARA5
• Synonyms (NCBI Gene): NET33, Tesr
• Chromosome: 8
• Chromosome location: 8p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018593	hsa-miR-335-5p	Microarray	18185580
MIRT1328439	hsa-miR-3130-3p	CLIP-seq
MIRT1328440	hsa-miR-3171	CLIP-seq
MIRT1328441	hsa-miR-331-5p	CLIP-seq
MIRT1328442	hsa-miR-380	CLIP-seq
MIRT1328443	hsa-miR-3909	CLIP-seq
MIRT1328444	hsa-miR-3941	CLIP-seq
MIRT1328445	hsa-miR-4495	CLIP-seq
MIRT1328446	hsa-miR-466	CLIP-seq
MIRT1328447	hsa-miR-4672	CLIP-seq
MIRT1328448	hsa-miR-4678	CLIP-seq
MIRT1328449	hsa-miR-4716-5p	CLIP-seq
MIRT2097478	hsa-miR-3678-3p	CLIP-seq
MIRT2097479	hsa-miR-4268	CLIP-seq
MIRT2097480	hsa-miR-4277	CLIP-seq
MIRT2097481	hsa-miR-4448	CLIP-seq
MIRT1328445	hsa-miR-4495	CLIP-seq
MIRT2097482	hsa-miR-4802-5p	CLIP-seq
MIRT2097483	hsa-miR-767-3p	CLIP-seq
MIRT2321776	hsa-miR-3127-5p	CLIP-seq
MIRT2321777	hsa-miR-3918	CLIP-seq
MIRT2097479	hsa-miR-4268	CLIP-seq
MIRT2440040	hsa-miR-1179	CLIP-seq
MIRT2440041	hsa-miR-3622a-3p	CLIP-seq
MIRT2440042	hsa-miR-3622b-3p	CLIP-seq
MIRT2440043	hsa-miR-4310	CLIP-seq
MIRT2440044	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	ISS
GO:0006897	Process	Endocytosis	IEA
GO:0006897	Process	Endocytosis	ISS
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0034755	Process	Iron ion transmembrane transport	IEA
GO:0034755	Process	Iron ion transmembrane transport	ISS
GO:0070207	Process	Protein homotrimerization	IEA
GO:0070207	Process	Protein homotrimerization	ISS
GO:0070287	Function	Ferritin receptor activity	IEA
GO:0070287	Function	Ferritin receptor activity	ISS

Other IDs

• MIM: 611306
• HGNC: 28701
• e!Ensembl: ENSG00000168079

Protein

• UniProt ID: Q6ZMJ2
• Protein name: Scavenger receptor class A member 5 (Scavenger receptor hlg)
• Protein function: Ferritin receptor that mediates non-transferrin-dependent delivery of iron. Mediates cellular uptake of ferritin-bound iron by stimulating ferritin endocytosis from the cell surface with consequent iron delivery within the cell. Delivery of iron
• PDB: 7C00
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	304 → 358	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	327 → 386	Collagen triple helix repeat (20 copies)	Repeat
  PF00530	SRCR	396 → 493	Scavenger receptor cysteine-rich domain	Domain

• Sequence:

  MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKH
  AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
  LTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDT
  AQLELYQLQVESNSSQLLLRRHAGLLDGLARRVGILGEELADVGGVLRGLNHSLSYDVAL
  HRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAMLNAVTEDLRLKDWEHSIALRN
  ISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDDGKLGATGPMG
  MRGFKGDRGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDD
  GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVT
  NCGHAEDASVTCNRH

• Sequence length: 495

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	27035566		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35008858	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27035566		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27579532, 28497372, 29908284		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29019900, 30249289, 35755171	Associate	★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	31208196		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36769209	Associate	★☆☆☆☆ Found in Text Mining only
Chondrocalcinosis 2	Chondrocalcinosis	Pubtator	35008858	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22399497		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31578828		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31578828	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35755171	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20038795, 22642751, 29019900, 29189991, 30249289		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27579532, 28497372, 29908284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29019900		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22642751, 26847210, 28497372, 29908284		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29908284		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31578828		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20038795, 22399497, 22642751, 26847210, 29189991, 29461673, 29908284		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35008858	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26847210		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25259650, 28640867		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29461673		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31217847		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33892811	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	40565055	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31208196		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31989658	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31989658	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37315873	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27035566		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	31420334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations