GPR37 (G protein-coupled receptor 37)

Gene

• Entrez ID: 2861
• Gene name: G protein-coupled receptor 37
• Gene symbol: GPR37
• Synonyms (NCBI Gene): EDNRBL, PAELR, hET(B)R-LP
• Chromosome: 7
• Chromosome location: 7q31.33
• Summary: This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018084	hsa-miR-335-5p	Microarray	18185580
MIRT024744	hsa-miR-215-5p	Microarray	19074876
MIRT026544	hsa-miR-192-5p	Microarray	19074876
MIRT027626	hsa-miR-98-5p	Microarray	19088304
MIRT733478	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT2005934	hsa-miR-3691-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	12150907
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9144577
GO:0005515	Function	Protein binding	IPI	14532270, 17519329, 28298427, 32814053
GO:0005737	Component	Cytoplasm	IDA	16443751
GO:0005783	Component	Endoplasmic reticulum	IDA	17059562
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11439185, 12150907
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9144577
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9144577
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	23690594
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	16443751
GO:0008188	Function	Neuropeptide receptor activity	IDA	16443751
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	23690594
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0009986	Component	Cell surface	IDA	16443751
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016358	Process	Dendrite development	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030544	Function	Hsp70 protein binding	IPI	12150907
GO:0031072	Function	Heat shock protein binding	IPI	12150907
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11439185, 12150907, 17059562
GO:0031987	Process	Locomotion involved in locomotory behavior	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	ISS	23690594
GO:0036505	Function	Prosaposin receptor activity	IBA
GO:0036505	Function	Prosaposin receptor activity	IDA	23690594
GO:0036505	Function	Prosaposin receptor activity	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0042277	Function	Peptide binding	IPI	23690594
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042923	Function	Neuropeptide binding	IPI	16443751
GO:0042995	Component	Cell projection	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23690594
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	IEA
GO:0045964	Process	Positive regulation of dopamine metabolic process	IEA

Other IDs

• MIM: 602583
• HGNC: 4494
• e!Ensembl: ENSG00000170775

Protein

• UniProt ID: O15354
• Protein name: Prosaposin receptor GPR37 (Endothelin B receptor-like protein 1) (ETBR-LP-1) (G-protein coupled receptor 37) (Parkin-associated endothelin receptor-like receptor) (PAELR)
• Protein function: G-protein-coupled receptor that plays a role in several physiological pathways such as resolution of inflammatory pain and oligodendrocyte differentiation (By similarity). Acts as a receptor for several ligands including prosaposin, osteocalcin
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	278 → 549	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and spinal cord, and at lower levels in testis, placenta and liver, but no detectable expression observed in any other tissue. When overexpressed in cells, tends to become insoluble and unfolded. Accumulation of the
• Sequence:

  MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
  NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
  RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
  YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
  TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
  ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
  RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
  IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
  KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
  KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
  REMSTFASVGTHC

• Sequence length: 613

Pathways

KEGG:

Parkinson disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autism Spectrum Disorder	Autism	Pubtator	23251443	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23251443, 25977097		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25977097		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35045088	Associate	★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	28842709		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31268736		★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	35045088	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	28165464		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	GWASCAT_DG	26237428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating Diseases	BEFREE	28642167		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37837549	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31268736		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11313277	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25169131		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	26237428		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	26237428		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27036049		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28642167		★☆☆☆☆ Found in Text Mining only
Myoclonic Epilepsies, Progressive	Myoclonic epilepsy	BEFREE	28688853		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16443751, 18691389, 19218498, 21731658, 23121049, 23251443, 28007645, 28341812, 28629580, 28842709, 30423289		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21731658, 23251443	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33637132	Stimulate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	18691389, 28629580		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	33637132	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	23251443, 25977097		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	28165464		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27036049		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27036049	Associate	★☆☆☆☆ Found in Text Mining only