Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	285643
Gene name	Kinesin family member 4B
Gene symbol	KIF4B
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q33.2
Summary	This gene is an intronless retrocopy of kinesin family member 4A. The protein encoded by this gene is a microtubule-based motor protein that plays vital roles in anaphase spindle dynamics and cytokinesis. [provided by RefSeq, Jul 2016]

Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036533	hsa-miR-1226-3p	CLASH	23622248
MIRT1094868	hsa-miR-1200	CLIP-seq
MIRT1094869	hsa-miR-1305	CLIP-seq
MIRT1094870	hsa-miR-155	CLIP-seq
MIRT1094871	hsa-miR-2278	CLIP-seq
MIRT1094872	hsa-miR-3614-3p	CLIP-seq
MIRT1094873	hsa-miR-375	CLIP-seq
MIRT1094874	hsa-miR-4326	CLIP-seq
MIRT1094875	hsa-miR-4468	CLIP-seq
MIRT1094876	hsa-miR-4502	CLIP-seq
MIRT1094877	hsa-miR-4515	CLIP-seq
MIRT1094878	hsa-miR-4777-5p	CLIP-seq
MIRT1094879	hsa-miR-518d-5p	CLIP-seq
MIRT1094880	hsa-miR-519b-5p	CLIP-seq
MIRT1094881	hsa-miR-519c-5p	CLIP-seq
MIRT1094882	hsa-miR-520c-5p	CLIP-seq
MIRT1094883	hsa-miR-526a	CLIP-seq
MIRT1094868	hsa-miR-1200	CLIP-seq
MIRT2025458	hsa-miR-15a	CLIP-seq
MIRT2025459	hsa-miR-15b	CLIP-seq
MIRT2025460	hsa-miR-16	CLIP-seq
MIRT2025461	hsa-miR-195	CLIP-seq
MIRT2025462	hsa-miR-424	CLIP-seq
MIRT1094876	hsa-miR-4502	CLIP-seq
MIRT1094877	hsa-miR-4515	CLIP-seq
MIRT2025463	hsa-miR-4524	CLIP-seq
MIRT2025464	hsa-miR-497	CLIP-seq
MIRT2025465	hsa-miR-503	CLIP-seq
MIRT2025466	hsa-miR-646	CLIP-seq
MIRT1094868	hsa-miR-1200	CLIP-seq
MIRT2256712	hsa-miR-335	CLIP-seq
MIRT1094876	hsa-miR-4502	CLIP-seq
MIRT1094877	hsa-miR-4515	CLIP-seq
MIRT2256713	hsa-miR-4666-3p	CLIP-seq
MIRT2256714	hsa-miR-4729	CLIP-seq
MIRT1094868	hsa-miR-1200	CLIP-seq
MIRT1094876	hsa-miR-4502	CLIP-seq
MIRT1094877	hsa-miR-4515	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IMP	15843429
GO:0003677	Function	DNA binding	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005875	Component	Microtubule associated complex	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051231	Process	Spindle elongation	IBA
GO:0051256	Process	Mitotic spindle midzone assembly	IEA
GO:0051256	Process	Mitotic spindle midzone assembly	IMP	15843429
GO:0051536	Function	Iron-sulfur cluster binding	IEA

MIM	HGNC	e!Ensembl
609184	6322	ENSG00000226650

Q2VIQ3

Protein name

Chromosome-associated kinesin KIF4B (Chromokinesin-B)

Protein function

Iron-sulfur (Fe-S) cluster binding motor protein that has a role in chromosome segregation during mitosis (By similarity). Translocates PRC1 to the plus ends of interdigitating spindle microtubules during the metaphase to anaphase transition, an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	15 → 336	Kinesin motor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in testis. {ECO:0000269|PubMed:16201836}.

Sequence

MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGETQVVVGTDKSFTYDFVFDPCTE
QEEVFNKAVAPLIKGIFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGIIPRVIQ
LLFKEIDKKSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKT
VLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKSDKNCSFRSKLHLVD
LAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGSFVPYRDSKLTRLLQDS
LGGNSHTLMIACVSPADSNLEETLSTLRYADRARKIKNKPIVNIDPHTAELNHLKQQVQQ
LQVLLLQAHGGTLPGSINAEPSENLQSLMEKNQSLVEENEKLSRCLSKAAGQTAQMLERI
ILTEQVNEKLNAKLEELRQHVACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDET
VACTAAAIDTAVEEEAQVETSPETSRSSDAFTTQHALHQAQMSKEVVELNNALALKEALV
RKMTQNDNQLQPIQFQYQDNIKNLELEVINLQKEKEELVRELQTAKKNVNQAKLSEHRHK
LLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIWMMKNQRVQLMRQMKEDAEK
FRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSSVLRRKTEEAAAANKRLKDALQK
QREVTDKRKETQSHGKEGIAARVRNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVVQ
LKEKKESRENPPPKLRKCTFSLSEVHGQVLESEDCITKQIESLETEMELRSAQIADLQQK
LLDAESEDRPKQCWENIATILEAKCALKYLIGELVSSKIHVTKLENSLRQSKASCADMQK
MLFEEQNHFSEIETELQAELVRMEQQHQEKVLYLVSQLQESQMAEKQLEKSASEKEQQLV
STLQCQDEELEKMREVCEQNQQLLQENEIIKQKLILLQVASRQKHLPNDTLLSPDSSFEY
IPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDGDSDEGDDEEWKPTKLVKV
SRKNIQGCSCKGWCGNKQCGCRKQKSDCGVDCSCDPTKCRNRQQGKDSLGTVEQTQDSEG
SFKLEDPTEVTPGLSFFNPVCATPNSKILKEMCDMEQVLSKKTAPAPSPFDLPESKHGAT
EYQQNKPPGKKKKRALASNTSFFSGCSPIEEEAH

Sequence length

1234

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		MHC class II antigen presentation Recycling pathway of L1 COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF4B-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28901309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28901309		★★★★★ ★☆☆☆☆ Found in Text Mining only

KIF4B (kinesin family member 4B)