GPR32 (G protein-coupled receptor 32)

Gene

• Entrez ID: 2854
• Gene name: G protein-coupled receptor 32
• Gene symbol: GPR32
• Synonyms (NCBI Gene): DRV1, RVDR1
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19. [pro

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA
GO:0004875	Function	Complement receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9653656
GO:0004982	Function	N-formyl peptide receptor activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9653656
GO:0006954	Process	Inflammatory response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9653656
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 603195
• HGNC: 4487
• e!Ensembl: ENSG00000142511

Protein

• UniProt ID: O75388
• Protein name: Probable G-protein coupled receptor 32
• Protein function: G-protein coupled receptor that binds to several ligands including resolvin D1 (RvD1) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. In macrophages, enhances the RvD1-stimulated phagoc
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	60 → 316	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in resting primary human macrophages. {ECO:0000269|PubMed:26969756}.
• Sequence:

  MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLG
  NGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITF
  VFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFR
  TTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIR
  AKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQA
  SFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE

• Sequence length: 356

Pathways

Reactome:

G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Congestive heart failure	Congestive Heart Failure	BEFREE	30052486		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32670289	Associate	★☆☆☆☆ Found in Text Mining only