Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	285386
Gene name	Tumor protein p63 regulated 1
Gene symbol	TPRG1
Synonyms (NCBI Gene)	FAM79B
Chromosome	3
Chromosome location	3q28

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021515	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT756348	hsa-miR-129-5p	Western blottingqRT-PCR	37294527
MIRT1450212	hsa-miR-103a	CLIP-seq
MIRT1450213	hsa-miR-107	CLIP-seq
MIRT1450214	hsa-miR-1200	CLIP-seq
MIRT1450215	hsa-miR-1303	CLIP-seq
MIRT1450216	hsa-miR-1305	CLIP-seq
MIRT1450217	hsa-miR-132	CLIP-seq
MIRT1450218	hsa-miR-136	CLIP-seq
MIRT1450219	hsa-miR-144	CLIP-seq
MIRT1450220	hsa-miR-15a	CLIP-seq
MIRT1450221	hsa-miR-15b	CLIP-seq
MIRT1450222	hsa-miR-16	CLIP-seq
MIRT1450223	hsa-miR-195	CLIP-seq
MIRT1450224	hsa-miR-212	CLIP-seq
MIRT1450225	hsa-miR-214	CLIP-seq
MIRT1450226	hsa-miR-219-1-3p	CLIP-seq
MIRT1450227	hsa-miR-24	CLIP-seq
MIRT1450228	hsa-miR-298	CLIP-seq
MIRT1450229	hsa-miR-3065-3p	CLIP-seq
MIRT1450230	hsa-miR-3065-5p	CLIP-seq
MIRT1450231	hsa-miR-3074-5p	CLIP-seq
MIRT1450232	hsa-miR-31	CLIP-seq
MIRT1450233	hsa-miR-3123	CLIP-seq
MIRT1450234	hsa-miR-3124-3p	CLIP-seq
MIRT1450235	hsa-miR-3125	CLIP-seq
MIRT1450236	hsa-miR-3161	CLIP-seq
MIRT1450237	hsa-miR-3619-5p	CLIP-seq
MIRT1450238	hsa-miR-3682-3p	CLIP-seq
MIRT1450239	hsa-miR-369-3p	CLIP-seq
MIRT1450240	hsa-miR-374c	CLIP-seq
MIRT1450241	hsa-miR-383	CLIP-seq
MIRT1450242	hsa-miR-3916	CLIP-seq
MIRT1450243	hsa-miR-3921	CLIP-seq
MIRT1450244	hsa-miR-3925-5p	CLIP-seq
MIRT1450245	hsa-miR-424	CLIP-seq
MIRT1450246	hsa-miR-4269	CLIP-seq
MIRT1450247	hsa-miR-4291	CLIP-seq
MIRT1450248	hsa-miR-4310	CLIP-seq
MIRT1450249	hsa-miR-4324	CLIP-seq
MIRT1450250	hsa-miR-4432	CLIP-seq
MIRT1450251	hsa-miR-4438	CLIP-seq
MIRT1450252	hsa-miR-4446-3p	CLIP-seq
MIRT1450253	hsa-miR-4514	CLIP-seq
MIRT1450254	hsa-miR-4522	CLIP-seq
MIRT1450255	hsa-miR-4536	CLIP-seq
MIRT1450256	hsa-miR-4649-3p	CLIP-seq
MIRT1450257	hsa-miR-4653-5p	CLIP-seq
MIRT1450258	hsa-miR-4656	CLIP-seq
MIRT1450259	hsa-miR-4682	CLIP-seq
MIRT1450260	hsa-miR-4692	CLIP-seq
MIRT1450261	hsa-miR-4714-5p	CLIP-seq
MIRT1450262	hsa-miR-4721	CLIP-seq
MIRT1450263	hsa-miR-4729	CLIP-seq
MIRT1450264	hsa-miR-4742-5p	CLIP-seq
MIRT1450265	hsa-miR-4766-5p	CLIP-seq
MIRT1450266	hsa-miR-4772-5p	CLIP-seq
MIRT1450267	hsa-miR-4778-3p	CLIP-seq
MIRT1450268	hsa-miR-497	CLIP-seq
MIRT1450269	hsa-miR-499-5p	CLIP-seq
MIRT1450270	hsa-miR-539	CLIP-seq
MIRT1450271	hsa-miR-544b	CLIP-seq
MIRT1450272	hsa-miR-571	CLIP-seq
MIRT1450273	hsa-miR-579	CLIP-seq
MIRT1450274	hsa-miR-587	CLIP-seq
MIRT1450275	hsa-miR-655	CLIP-seq
MIRT1450276	hsa-miR-761	CLIP-seq
MIRT1450277	hsa-miR-922	CLIP-seq
MIRT1450278	hsa-miR-924	CLIP-seq
MIRT2134567	hsa-miR-1297	CLIP-seq
MIRT2134568	hsa-miR-26a	CLIP-seq
MIRT2134569	hsa-miR-26b	CLIP-seq
MIRT2134570	hsa-miR-4465	CLIP-seq
MIRT2134571	hsa-miR-548t	CLIP-seq
MIRT2355884	hsa-miR-21	CLIP-seq
MIRT2355885	hsa-miR-3153	CLIP-seq
MIRT2355886	hsa-miR-4668-5p	CLIP-seq
MIRT2355887	hsa-miR-548an	CLIP-seq
MIRT2355888	hsa-miR-590-5p	CLIP-seq
MIRT2355889	hsa-miR-635	CLIP-seq
MIRT1450278	hsa-miR-924	CLIP-seq
MIRT2649385	hsa-miR-3163	CLIP-seq
MIRT1450250	hsa-miR-4432	CLIP-seq
MIRT2649386	hsa-miR-4760-5p	CLIP-seq
MIRT1450269	hsa-miR-499-5p	CLIP-seq
MIRT2649387	hsa-miR-513a-3p	CLIP-seq
MIRT2649388	hsa-miR-577	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6ZUI0

Protein name

Tumor protein p63-regulated gene 1 protein (Protein FAM79B)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12456	hSac2	65 → 172	Inositol phosphatase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the epidermal layer of the skin. {ECO:0000269|PubMed:18256694}.

Sequence

MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQP
YISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTL
LICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLS
RWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLM
VLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF

Sequence length

275

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC KERATOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	30961553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	19963137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	19963137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37481637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TPRG1 (tumor protein p63 regulated 1)