Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2853
Gene name	G protein-coupled receptor 31
Gene symbol	GPR31
Synonyms (NCBI Gene)	12-HETERHETERHETER1
Chromosome	6
Chromosome location	6q27

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002237	Process	Response to molecule of bacterial origin	IEA
GO:0002237	Process	Response to molecule of bacterial origin	ISS
GO:0002931	Process	Response to ischemia	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	21712392, 31119277
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9205127
GO:0005515	Function	Protein binding	IPI	28619714
GO:0005886	Component	Plasma membrane	IDA	21712392, 28619714
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9205127
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	21712392, 31119277
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9205127
GO:0010447	Process	Response to acidic pH	IDA	31119277
GO:0016020	Component	Membrane	IEA
GO:0045125	Function	Bioactive lipid receptor activity	IBA
GO:0045125	Function	Bioactive lipid receptor activity	IEA
GO:0050544	Function	Arachidonate binding	IDA	21712392
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050778	Process	Positive regulation of immune response	IEA

MIM	HGNC	e!Ensembl
602043	4486	ENSG00000120436

O00270

Protein name

12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor (12-(S)-HETE receptor) (12-HETER) (G-protein coupled receptor 31) (GPR31/12-HETER)

Protein function

High-affinity receptor for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (12-S-HETE), with much lower affinities for other HETE isomers (PubMed:21712392, PubMed:29227475). 12-S-HETE is a eicosanoid, a 12-lipoxygenase (ALOX12) metabolite of arac

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	31 → 282	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALAD
LLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPR
LKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEA
LSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFL
ARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTL
RGKGQAAEPPDFNPRDSYS

Sequence length

319

Interactions

View interactions

	Reactome
			G alpha (i) signalling events Free fatty acid receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35011589	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30416315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30416315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26965684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30902921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31831037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26965684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35011589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GPR31 (G protein-coupled receptor 31)