GPER1 (G protein-coupled estrogen receptor 1)

Gene

• Entrez ID: 2852
• Gene name: G protein-coupled estrogen receptor 1
• Gene symbol: GPER1
• Synonyms (NCBI Gene): CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR, mER
• Chromosome: 7
• Chromosome location: 7p22.3
• Summary: This gene encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum and a member of the G-protein coupled receptor 1 family. This receptor binds estrogen and activates multiple downstream signaling pathways, leading to stimulation

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736810	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31545414

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	20551055, 21427217
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001956	Process	Positive regulation of neurotransmitter secretion	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002695	Process	Negative regulation of leukocyte activation	IDA	23285008
GO:0003682	Function	Chromatin binding	IDA	20551055
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8920907
GO:0005496	Function	Steroid binding	IDA	15539556, 15705806
GO:0005515	Function	Protein binding	IPI	20551055, 21149639, 23674134
GO:0005634	Component	Nucleus	IDA	20551055, 23285008
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	15705806
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21540189
GO:0005769	Component	Early endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15705806, 21540189
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	15705806
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	21540189
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	15705806
GO:0005886	Component	Plasma membrane	IDA	15539556, 19931550, 21149639, 21427217, 21540189, 23674134
GO:0005886	Component	Plasma membrane	TAS	8920907
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	23840305
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8920907
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	15539556
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20551055
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	23840305
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IMP	23840305
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010948	Process	Negative regulation of cell cycle process	IMP	23840305
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0019228	Process	Neuronal action potential	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030263	Process	Apoptotic chromosome condensation	ISS
GO:0030264	Process	Nuclear fragmentation involved in apoptotic nuclear change	ISS
GO:0030284	Function	Nuclear estrogen receptor activity	IBA
GO:0030284	Function	Nuclear estrogen receptor activity	IDA	15539556, 15705806
GO:0030284	Function	Nuclear estrogen receptor activity	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	20551055
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IBA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IDA	15705806
GO:0030659	Component	Cytoplasmic vesicle membrane	IDA	21540189
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032591	Component	Dendritic spine membrane	ISS
GO:0032962	Process	Positive regulation of inositol trisphosphate biosynthetic process	IDA	15705806
GO:0038054	Function	G protein-coupled estrogen receptor activity	ISS
GO:0042311	Process	Vasodilation	ISS
GO:0042734	Component	Presynaptic membrane	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043198	Component	Dendritic shaft	ISS
GO:0043401	Process	Steroid hormone receptor signaling pathway	IDA	19931550
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0043679	Component	Axon terminus	ISS
GO:0044327	Component	Dendritic spine head	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045095	Component	Keratin filament	IDA	21149639
GO:0045202	Component	Synapse	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	15705806
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	15539556
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20551055
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21540189
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048786	Component	Presynaptic active zone	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IDA	23285008
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051050	Process	Positive regulation of transport	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	15705806
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	15705806
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	23840305
GO:0055037	Component	Recycling endosome	IDA	21540189
GO:0055037	Component	Recycling endosome	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	23840305
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	20551055, 21427217
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IDA	21427217
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	23285008
GO:0071375	Process	Cellular response to peptide hormone stimulus	IDA	21427217
GO:0071389	Process	Cellular response to mineralocorticoid stimulus	ISS
GO:0071392	Process	Cellular response to estradiol stimulus	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	15539556, 15705806, 19931550, 20551055, 21149639, 21427217, 21540189, 23285008
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	ISS
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	23674134
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	23840305
GO:1990239	Function	Steroid hormone binding	IDA	19931550
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	ISS
GO:2000724	Process	Positive regulation of cardiac vascular smooth muscle cell differentiation	IMP	23840305
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	ISS

Other IDs

• MIM: 601805
• HGNC: 4485
• e!Ensembl: ENSG00000164850

Protein

• UniProt ID: Q99527
• Protein name: G-protein coupled estrogen receptor 1 (Chemoattractant receptor-like 2) (Flow-induced endothelial G-protein coupled receptor 1) (FEG-1) (G protein-coupled estrogen receptor 1) (G-protein coupled receptor 30) (GPCR-Br) (IL8-related receptor DRY12) (Lymphoc
• Protein function: G-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine ki
• PDB: 8XOF, 8XOG, 8XOH, 8XOI, 8XOJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	76 → 324	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta, endothelial and epithelial cells, non laboring and laboring term myometrium, fibroblasts and cancer-associated fibroblasts (CAF), prostate cancer cells and invasive adenocarcinoma (at protein level). Ubiquitously
• Sequence:

  MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF
  LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH
  ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL
  IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
  LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
  AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI
  PDSTEQSDVRFSSAV

• Sequence length: 375

Pathways

KEGG:

Endocrine resistance
Hormone signaling
Estrogen signaling pathway
GnRH secretion

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30227306, 31483053		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36697247	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	22002330, 31483053		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	36384894	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28061972, 28465157		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28061972, 28465157		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17452498, 28709892		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29706963		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17452498, 28709892		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	33875621	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29659348		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37673435	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19059436, 27189345		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27849354, 28412354		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29618927		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26090392		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11897506, 17308128, 19744559, 19911269, 20086172, 20551055, 21266576, 22147081, 22525040, 22576740, 23056216, 23554355, 23688258, 24019118, 24169358, 24275097, 24289103, 24515910, 24553912, 24628533, 24928526, 25063027, 25672442, 25928008, 26225773, 26585158, 26690777, 27837347, 28118074, 28249728, 28286086, 28450397, 28596490, 28671018, 28789417, 29096683, 29177974, 29212519, 29290975, 29745344, 29899833, 29964007, 29996493, 30478301, 30478785, 30545896, 30760632, 31082617, 31242463, 31277940, 31340060, 31632554, 31749762, 9367686		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	24440569		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15090535, 18467441, 19153601, 19749156, 19902352, 20211987, 22251451, 22290080, 22552965, 23056216, 23135268, 24421881, 24481325, 24515910, 24553912, 24718936, 25496649, 25928008, 26415222, 26470790, 26646587, 26888479, 27072893, 27448983, 28096479, 28450397, 28596490, 29212519, 30728047, 30760632, 30866584, 31370872, 32143514, 32302351, 32357920, 33117280, 34299224, 34329471, 34602561, 35061800, 36077069, 37148752, 37863936, 39201247, 39571822	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20086172	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8920907		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9141481	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22270964, 24451139, 37257767	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	17638621	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	17638621	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	21278491	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26090392		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19501895, 23951246, 33679613, 37276925	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25588050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23951246, 25167139, 29239277		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	20605134	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	19179659		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23674134, 28278256, 30354811		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	24319683		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29484405, 31295444		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22869326, 30001721		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25753185, 31507337		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25753185, 31507337		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	26152119		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	26152119		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29090346		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	19549922		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	36384894	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27220899	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27940297		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36697247	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31735968		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28338111, 31261736	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31096733		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36384894	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29137421		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33795755, 36293473, 36384894	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17452498		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17452498		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17452498		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28338111, 31261736		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28338111, 31261736	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	22495744		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29073745		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29255468, 30116239		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31713438		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21521748, 30227089		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30592156	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30218860		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	24966932	Stimulate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	17638621		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16239258, 17403429, 19432902, 19549922, 22075757, 22147081, 22415229, 23142288, 23235274, 24039841, 26638889, 27889612, 28189066, 29207611, 30836961, 31545414, 31737560		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	27516013	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19432902, 22270964, 22415229, 24039841, 27516013, 37257767	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36769338	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	22495744, 25724739		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19549922, 22495744, 23458722, 25724739, 26453052, 27939762		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22378861, 22520060, 23755949, 27939762, 32444257	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	29758456		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23951246, 25167139		★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	27314054		★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30165855		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	23043685, 26416628, 26773178, 31016847		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	26617848		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	25167139		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	25531203		★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG	30165855		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	23674134		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	31040364	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	34329471	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	19079715, 32321334	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	33799631	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27213340		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29885598		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32783656, 35446883, 37827440	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25039431, 26200092, 27213340, 28285016, 29790948, 30354811		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31265816		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30542605		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32778144	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30165855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infertility	Infertility	Pubtator	21269226	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28338111		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28338111	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29255468, 30116239		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35042389	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24628533		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31040364		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31040364	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24966932	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29484405, 30001721		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28466560		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23043685, 26416628, 26773178, 31468104, 32321334, 33818655	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36316313	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36316313	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	9141481	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30340900		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	31759407		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30641053		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19995644, 27384677, 39849531	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29255468		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29255468		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29255468		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29255468		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22495744	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25031742, 37762008	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29073745		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11897506, 17308128, 19744559, 19911269, 20086172, 20551055, 21266576, 22147081, 22525040, 22576740, 23056216, 23554355, 23688258, 24019118, 24169358, 24275097, 24289103, 24515910, 24553912, 24928526, 25063027, 25672442, 25928008, 26225773, 26585158, 26690777, 27837347, 28118074, 28249728, 28286086, 28450397, 28596490, 28671018, 28789417, 28824547, 29096683, 29177974, 29212519, 29290975, 29745344, 29899833, 29964007, 29996493, 30258538, 30478301, 30478785, 30545896, 30760632, 31082617, 31242463, 31277940, 31340060, 31632554, 31749762, 9367686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	24440569		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16239258, 17403429, 19432902, 22075757, 22147081, 23142288, 23235274, 24039841, 26638889, 27889612, 29207611, 30836961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30641053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29239277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20203690, 26506594, 27908592, 29094395, 30919959		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15771623, 29285287, 31028714		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28882636, 31790688		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26090392		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19432902, 22430216, 22495744, 24275097, 26189910, 26253279, 27189345, 27314054, 28251492, 28285016, 28596490, 29207611, 29239277, 29285287, 29290975, 29434888, 31082617		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25753185, 31507337		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	24440569		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11043579, 23554355, 24928526, 27341075, 28249728, 28286086, 29212519, 30687231, 31082617		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11897506, 15090535, 18289622, 18467441		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	24440569		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	24440569		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28403073, 34833446, 39252786	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	39252786	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29073745		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29229551		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24037776		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30041006, 31513775		★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CTD_human_DG	21984484		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37759449	Inhibit	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	28251492		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28851810, 30905784		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19744559, 22495744, 23951246, 24289103, 24515910, 24553912, 24628533, 25167139, 25287069, 27000991, 27314054, 28251492, 28286086, 29096683, 29383185, 29385707, 29996493, 30478301, 31096733, 31340060, 31483053, 9367686		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31513775		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29421611, 29535608, 31513775		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25372020		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26189910, 30385288		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20086172, 23554355, 25275589, 27448983, 28902352		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	37506161	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31061445, 31298483		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30341688	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	22495744	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29239277		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19079715, 19501895, 22495744, 23951246, 25616260, 29239277, 33679613, 33799631, 37131060, 37610061	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31540491	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31568691		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36077069	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27796870		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	37430099	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21269226	Inhibit	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16675557		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	19501895	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20203690, 26506594, 27908592, 29094395, 30919959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	35672281	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	26714890	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39596074	Associate	★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	24037776		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29212519		★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	20300561		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29706963		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	29385707	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	21278491, 24451139	Stimulate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	24451139		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	24451139	Associate	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15911427		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29255468		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31611744		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15771623, 29285287, 31028714		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15771623, 31028714	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37487261	Inhibit	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31295444		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	29675990		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	21278491, 23300844, 24451139	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25031742, 35162942	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34273443	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28882636, 31790688		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	26617848		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28882636, 31790688		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34273443	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22290080, 24515910, 24553912, 25496649, 27959426, 29758456, 30405852, 30999280, 31632554		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22290080, 24515910, 24553912, 25496649, 29059676, 30728047, 39201674	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	28251492		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31261736		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29073745		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37093686	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	20605134, 27516013, 37257767	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23043685, 26416628, 26773178, 31016847		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37035582	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33875621	Associate	★☆☆☆☆ Found in Text Mining only
Vascular ring	Vascular ring	BEFREE	17452498		★☆☆☆☆ Found in Text Mining only