Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	285195
Gene name	Solute carrier family 9 member A9
Gene symbol	SLC9A9
Synonyms (NCBI Gene)	AUTS16NHE9
Chromosome	3
Chromosome location	3q24
Summary	This gene encodes a sodium/proton exchanger that is a member of the solute carrier 9 protein family. The encoded protein localizes the to the late recycling endosomes and may play an important role in maintaining cation homeostasis. Mutations in this gene

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121912597	G>A	Risk-factor	Stop gained, coding sequence variant, genic downstream transcript variant

213

Show/Hide all (213)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022577	hsa-miR-124-3p	Microarray	18668037
MIRT1369204	hsa-miR-1207-5p	CLIP-seq
MIRT1369205	hsa-miR-1285	CLIP-seq
MIRT1369206	hsa-miR-146b-3p	CLIP-seq
MIRT1369207	hsa-miR-1913	CLIP-seq
MIRT1369208	hsa-miR-3173-5p	CLIP-seq
MIRT1369209	hsa-miR-3187-5p	CLIP-seq
MIRT1369210	hsa-miR-3194-3p	CLIP-seq
MIRT1369211	hsa-miR-324-3p	CLIP-seq
MIRT1369212	hsa-miR-326	CLIP-seq
MIRT1369213	hsa-miR-330-5p	CLIP-seq
MIRT1369214	hsa-miR-378g	CLIP-seq
MIRT1369215	hsa-miR-4292	CLIP-seq
MIRT1369216	hsa-miR-4436b-3p	CLIP-seq
MIRT1369217	hsa-miR-4437	CLIP-seq
MIRT1369218	hsa-miR-4486	CLIP-seq
MIRT1369219	hsa-miR-4674	CLIP-seq
MIRT1369220	hsa-miR-4712-5p	CLIP-seq
MIRT1369221	hsa-miR-4761-3p	CLIP-seq
MIRT1369222	hsa-miR-4763-3p	CLIP-seq
MIRT1369223	hsa-miR-604	CLIP-seq
MIRT1369224	hsa-miR-612	CLIP-seq
MIRT1369225	hsa-miR-615-5p	CLIP-seq
MIRT1369226	hsa-miR-647	CLIP-seq
MIRT1369227	hsa-miR-760	CLIP-seq
MIRT1369228	hsa-miR-770-5p	CLIP-seq
MIRT1369229	hsa-miR-874	CLIP-seq
MIRT1369230	hsa-miR-942	CLIP-seq
MIRT1369205	hsa-miR-1285	CLIP-seq
MIRT2109660	hsa-miR-1290	CLIP-seq
MIRT1369206	hsa-miR-146b-3p	CLIP-seq
MIRT1369207	hsa-miR-1913	CLIP-seq
MIRT2109661	hsa-miR-3167	CLIP-seq
MIRT1369208	hsa-miR-3173-5p	CLIP-seq
MIRT1369209	hsa-miR-3187-5p	CLIP-seq
MIRT1369210	hsa-miR-3194-3p	CLIP-seq
MIRT1369211	hsa-miR-324-3p	CLIP-seq
MIRT1369212	hsa-miR-326	CLIP-seq
MIRT1369213	hsa-miR-330-5p	CLIP-seq
MIRT2109662	hsa-miR-335	CLIP-seq
MIRT1369214	hsa-miR-378g	CLIP-seq
MIRT1369215	hsa-miR-4292	CLIP-seq
MIRT1369217	hsa-miR-4437	CLIP-seq
MIRT1369218	hsa-miR-4486	CLIP-seq
MIRT1369219	hsa-miR-4674	CLIP-seq
MIRT2109663	hsa-miR-4698	CLIP-seq
MIRT2109664	hsa-miR-4782-5p	CLIP-seq
MIRT2109665	hsa-miR-498	CLIP-seq
MIRT1369224	hsa-miR-612	CLIP-seq
MIRT1369225	hsa-miR-615-5p	CLIP-seq
MIRT1369227	hsa-miR-760	CLIP-seq
MIRT1369229	hsa-miR-874	CLIP-seq
MIRT2109666	hsa-miR-876-5p	CLIP-seq
MIRT1369230	hsa-miR-942	CLIP-seq
MIRT2332908	hsa-miR-495	CLIP-seq
MIRT2394826	hsa-miR-1253	CLIP-seq
MIRT2394827	hsa-miR-3150a-3p	CLIP-seq
MIRT2394828	hsa-miR-3175	CLIP-seq
MIRT2394829	hsa-miR-3675-5p	CLIP-seq
MIRT2394830	hsa-miR-4434	CLIP-seq
MIRT2394831	hsa-miR-4516	CLIP-seq
MIRT2394832	hsa-miR-939	CLIP-seq
MIRT2627251	hsa-miR-1	CLIP-seq
MIRT1369204	hsa-miR-1207-5p	CLIP-seq
MIRT2627252	hsa-miR-124	CLIP-seq
MIRT2394826	hsa-miR-1253	CLIP-seq
MIRT2627253	hsa-miR-1257	CLIP-seq
MIRT2627254	hsa-miR-128	CLIP-seq
MIRT2627255	hsa-miR-1296	CLIP-seq
MIRT2627256	hsa-miR-1301	CLIP-seq
MIRT2627257	hsa-miR-140-3p	CLIP-seq
MIRT2627258	hsa-miR-153	CLIP-seq
MIRT2627259	hsa-miR-205	CLIP-seq
MIRT2627260	hsa-miR-206	CLIP-seq
MIRT2627261	hsa-miR-2116	CLIP-seq
MIRT2627262	hsa-miR-2909	CLIP-seq
MIRT2394827	hsa-miR-3150a-3p	CLIP-seq
MIRT2627263	hsa-miR-3162-3p	CLIP-seq
MIRT2394828	hsa-miR-3175	CLIP-seq
MIRT2627264	hsa-miR-323-3p	CLIP-seq
MIRT2627265	hsa-miR-330-3p	CLIP-seq
MIRT2627266	hsa-miR-3545-5p	CLIP-seq
MIRT2627267	hsa-miR-3613-3p	CLIP-seq
MIRT2627268	hsa-miR-3673	CLIP-seq
MIRT2394829	hsa-miR-3675-5p	CLIP-seq
MIRT2627269	hsa-miR-3938	CLIP-seq
MIRT2627270	hsa-miR-409-3p	CLIP-seq
MIRT2627271	hsa-miR-4269	CLIP-seq
MIRT2627272	hsa-miR-4273	CLIP-seq
MIRT2627273	hsa-miR-4286	CLIP-seq
MIRT2627274	hsa-miR-432	CLIP-seq
MIRT2627275	hsa-miR-4422	CLIP-seq
MIRT2394830	hsa-miR-4434	CLIP-seq
MIRT1369216	hsa-miR-4436b-3p	CLIP-seq
MIRT2627276	hsa-miR-4453	CLIP-seq
MIRT2627277	hsa-miR-4477b	CLIP-seq
MIRT2627278	hsa-miR-448	CLIP-seq
MIRT2627279	hsa-miR-4503	CLIP-seq
MIRT2627280	hsa-miR-4514	CLIP-seq
MIRT2394831	hsa-miR-4516	CLIP-seq
MIRT2627281	hsa-miR-4538	CLIP-seq
MIRT2627282	hsa-miR-4660	CLIP-seq
MIRT2627283	hsa-miR-4677-5p	CLIP-seq
MIRT2627284	hsa-miR-4681	CLIP-seq
MIRT2627285	hsa-miR-4692	CLIP-seq
MIRT1369220	hsa-miR-4712-5p	CLIP-seq
MIRT2627286	hsa-miR-4717-3p	CLIP-seq
MIRT2627287	hsa-miR-4742-5p	CLIP-seq
MIRT2627288	hsa-miR-4747-5p	CLIP-seq
MIRT2627289	hsa-miR-4753-5p	CLIP-seq
MIRT2627290	hsa-miR-4760-3p	CLIP-seq
MIRT1369221	hsa-miR-4761-3p	CLIP-seq
MIRT1369222	hsa-miR-4763-3p	CLIP-seq
MIRT2627291	hsa-miR-4790-3p	CLIP-seq
MIRT2627292	hsa-miR-490-3p	CLIP-seq
MIRT2332908	hsa-miR-495	CLIP-seq
MIRT2627293	hsa-miR-5047	CLIP-seq
MIRT2627294	hsa-miR-506	CLIP-seq
MIRT2627295	hsa-miR-545	CLIP-seq
MIRT2627296	hsa-miR-548ae	CLIP-seq
MIRT2627297	hsa-miR-548aj	CLIP-seq
MIRT2627298	hsa-miR-548am	CLIP-seq
MIRT2627299	hsa-miR-548an	CLIP-seq
MIRT2627300	hsa-miR-548x	CLIP-seq
MIRT2627301	hsa-miR-578	CLIP-seq
MIRT2627302	hsa-miR-579	CLIP-seq
MIRT1369223	hsa-miR-604	CLIP-seq
MIRT2627303	hsa-miR-613	CLIP-seq
MIRT2627304	hsa-miR-616	CLIP-seq
MIRT2627305	hsa-miR-626	CLIP-seq
MIRT1369226	hsa-miR-647	CLIP-seq
MIRT2627306	hsa-miR-664	CLIP-seq
MIRT1369228	hsa-miR-770-5p	CLIP-seq
MIRT2627307	hsa-miR-875-5p	CLIP-seq
MIRT2394832	hsa-miR-939	CLIP-seq
MIRT2627251	hsa-miR-1	CLIP-seq
MIRT1369204	hsa-miR-1207-5p	CLIP-seq
MIRT2627252	hsa-miR-124	CLIP-seq
MIRT2394826	hsa-miR-1253	CLIP-seq
MIRT2627253	hsa-miR-1257	CLIP-seq
MIRT2627254	hsa-miR-128	CLIP-seq
MIRT2627255	hsa-miR-1296	CLIP-seq
MIRT2627256	hsa-miR-1301	CLIP-seq
MIRT2627257	hsa-miR-140-3p	CLIP-seq
MIRT2627260	hsa-miR-206	CLIP-seq
MIRT2627261	hsa-miR-2116	CLIP-seq
MIRT2627262	hsa-miR-2909	CLIP-seq
MIRT2691319	hsa-miR-3144-5p	CLIP-seq
MIRT2394827	hsa-miR-3150a-3p	CLIP-seq
MIRT2627263	hsa-miR-3162-3p	CLIP-seq
MIRT2691320	hsa-miR-3174	CLIP-seq
MIRT2394828	hsa-miR-3175	CLIP-seq
MIRT2627264	hsa-miR-323-3p	CLIP-seq
MIRT2627265	hsa-miR-330-3p	CLIP-seq
MIRT2627266	hsa-miR-3545-5p	CLIP-seq
MIRT2627267	hsa-miR-3613-3p	CLIP-seq
MIRT2691321	hsa-miR-3649	CLIP-seq
MIRT2627268	hsa-miR-3673	CLIP-seq
MIRT2394829	hsa-miR-3675-5p	CLIP-seq
MIRT2691322	hsa-miR-370	CLIP-seq
MIRT2627269	hsa-miR-3938	CLIP-seq
MIRT2627270	hsa-miR-409-3p	CLIP-seq
MIRT2627271	hsa-miR-4269	CLIP-seq
MIRT2627272	hsa-miR-4273	CLIP-seq
MIRT2691323	hsa-miR-4276	CLIP-seq
MIRT2627273	hsa-miR-4286	CLIP-seq
MIRT2691324	hsa-miR-431	CLIP-seq
MIRT2627274	hsa-miR-432	CLIP-seq
MIRT2627275	hsa-miR-4422	CLIP-seq
MIRT2394830	hsa-miR-4434	CLIP-seq
MIRT1369216	hsa-miR-4436b-3p	CLIP-seq
MIRT2627276	hsa-miR-4453	CLIP-seq
MIRT2627277	hsa-miR-4477b	CLIP-seq
MIRT2627279	hsa-miR-4503	CLIP-seq
MIRT2627280	hsa-miR-4514	CLIP-seq
MIRT2394831	hsa-miR-4516	CLIP-seq
MIRT2627281	hsa-miR-4538	CLIP-seq
MIRT2627282	hsa-miR-4660	CLIP-seq
MIRT2627283	hsa-miR-4677-5p	CLIP-seq
MIRT2627284	hsa-miR-4681	CLIP-seq
MIRT2627285	hsa-miR-4692	CLIP-seq
MIRT1369220	hsa-miR-4712-5p	CLIP-seq
MIRT2627286	hsa-miR-4717-3p	CLIP-seq
MIRT2627287	hsa-miR-4742-5p	CLIP-seq
MIRT2627288	hsa-miR-4747-5p	CLIP-seq
MIRT2627289	hsa-miR-4753-5p	CLIP-seq
MIRT1369221	hsa-miR-4761-3p	CLIP-seq
MIRT1369222	hsa-miR-4763-3p	CLIP-seq
MIRT2627291	hsa-miR-4790-3p	CLIP-seq
MIRT2627292	hsa-miR-490-3p	CLIP-seq
MIRT2691325	hsa-miR-492	CLIP-seq
MIRT2332908	hsa-miR-495	CLIP-seq
MIRT2627293	hsa-miR-5047	CLIP-seq
MIRT2627294	hsa-miR-506	CLIP-seq
MIRT2627295	hsa-miR-545	CLIP-seq
MIRT2627296	hsa-miR-548ae	CLIP-seq
MIRT2627297	hsa-miR-548aj	CLIP-seq
MIRT2627298	hsa-miR-548am	CLIP-seq
MIRT2627299	hsa-miR-548an	CLIP-seq
MIRT2627300	hsa-miR-548x	CLIP-seq
MIRT2627301	hsa-miR-578	CLIP-seq
MIRT1369223	hsa-miR-604	CLIP-seq
MIRT2627303	hsa-miR-613	CLIP-seq
MIRT2627304	hsa-miR-616	CLIP-seq
MIRT2627305	hsa-miR-626	CLIP-seq
MIRT2691326	hsa-miR-627	CLIP-seq
MIRT2691327	hsa-miR-630	CLIP-seq
MIRT2691328	hsa-miR-643	CLIP-seq
MIRT1369226	hsa-miR-647	CLIP-seq
MIRT1369228	hsa-miR-770-5p	CLIP-seq
MIRT2627307	hsa-miR-875-5p	CLIP-seq
MIRT2691329	hsa-miR-924	CLIP-seq
MIRT2394832	hsa-miR-939	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18057008, 24705354
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	24065030
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006885	Process	Regulation of pH	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	IBA
GO:0015385	Function	Sodium:proton antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	TAS
GO:0015386	Function	Potassium:proton antiporter activity	IBA
GO:0015386	Function	Potassium:proton antiporter activity	IEA
GO:0015386	Function	Potassium:proton antiporter activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	TAS
GO:0032009	Component	Early phagosome	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0051453	Process	Regulation of intracellular pH	IBA
GO:0051453	Process	Regulation of intracellular pH	IDA	15522866, 24065030
GO:0051453	Process	Regulation of intracellular pH	IEA
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	IDA	15522866, 24065030
GO:0055038	Component	Recycling endosome membrane	IDA	15522866
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0090382	Process	Phagosome maturation	IEA
GO:0098719	Process	Sodium ion import across plasma membrane	IBA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
608396	20653	ENSG00000181804

Q8IVB4

Protein name

Sodium/hydrogen exchanger 9 (Na(+)/H(+) exchanger 9) (NHE-9) (Solute carrier family 9 member 9)

Protein function

Endosomal Na(+), K(+)/H(+) antiporter. Mediates the electroneutral exchange of endosomal luminal H(+) for a cytosolic Na(+) or K(+) (Probable). By facilitating proton efflux, SLC9A9 counteracts the acidity generated by vacuolar (V)-ATPase, there

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00999	Na_H_Exchanger	28 → 486	Sodium/hydrogen exchanger family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissues tested. Expressed at highest levels in heart and skeletal muscle, followed by placenta, kidney, and liver. Expressed in the brain, in the medulla and spinal cord. {ECO:0000269|PubMed:14569117, ECO:

Sequence

MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGL
IMGLILRYATAPTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQG
NAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLI
MYGFVKAMIHAGQLKNGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGES
VLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLGIFAGSFAMGSAYAIITALLT
KFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKIR
TKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGT
TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPI
LTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCS
PPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN

Sequence length

645

Interactions

View interactions

	Reactome
			Sodium/Proton exchangers Defective SLC9A9 causes autism 16 (AUTS16)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Colorectal cancer	Pathogenic	rs1933531491	RCV001293845	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	ClinGen, GWAS catalog ClinGen, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism, susceptibility to, 16	Uncertain significance; risk factor; Likely benign	ClinVar ClinVar, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PENILE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC9A9-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31275360		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	GWASCAT_DG	27244217		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE	Amyotrophic lateral sclerosis	GWASCAT_DG	27244217		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder)	Amyotrophic lateral sclerosis	GWASCAT_DG	27244217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	GWASCAT_DG	27244217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29212874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	18937294, 20032819, 20732626, 23527680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20032819, 20732626, 21858920, 25875332, 29212874, 29362376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	23527680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23715297	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27439572, 29362376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18621663		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	23715297	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	24065030, 27439572		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior Disorders	Behavior Disorders	BEFREE	20032819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	25835977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28476790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29864786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	20032819, 23527680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26965387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18649358, 25835977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28476790, 29268774, 31532058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29268774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28476790, 29268774, 31532058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31250444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36781600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASDB_DG	19065144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked, Syndromic, Christianson Type	Mental retardation	BEFREE	29212874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25914168, 27766536		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29212874		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Autism	Autism	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	30956978		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	27047539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25835977	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	29362376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28476790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25835977		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC9A9 (solute carrier family 9 member A9)