DNAJC5G (DnaJ heat shock protein family (Hsp40) member C5 gamma)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 285126
Gene name DnaJ heat shock protein family (Hsp40) member C5 gamma
Gene symbol DNAJC5G
Synonyms (NCBI Gene)
CSP-gamma
Chromosome 2
Chromosome location 2p23.3
miRNA miRNA information provided by mirtarbase database.
37
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (37)
miRTarBase ID miRNA Experiments Reference
MIRT018125 hsa-miR-335-5p Microarray 18185580
MIRT447200 hsa-miR-103a-2-5p PAR-CLIP 22100165
MIRT447199 hsa-miR-3653-3p PAR-CLIP 22100165
MIRT447198 hsa-miR-526b-5p PAR-CLIP 22100165
MIRT447197 hsa-miR-4709-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
613946 24844 ENSG00000163793
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N7S2
Protein name DnaJ homolog subfamily C member 5G (Cysteine string protein-gamma) (CSP-gamma)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 53 → 95 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence 
MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRY
HPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILN
SCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFR
SEENSEDDF
Sequence length 189
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Protein processing in endoplasmic reticulum  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PSORIASIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Oropharyngeal Neoplasms Oropharyngeal neoplasm Pubtator 32415241 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only