ANGPT2 (angiopoietin 2)

Gene

• Entrez ID: 285
• Gene name: Angiopoietin 2
• Gene symbol: ANGPT2
• Synonyms (NCBI Gene): AGPT2, ANG2, LMPHM10
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: This gene belongs to the angiopoietin family of growth factors. The protein encoded by this gene is an antagonist of angiopoietin 1, and both angiopoietin 1 and angiopoietin 2 are ligands for the endothelial TEK receptor tyrosine kinase. Angiopoietin 2 is

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438013	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	24384875
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438013	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	24384875
MIRT732607	hsa-miR-17-3p	qRT-PCR	33909697
MIRT732608	hsa-miR-24-3p	qRT-PCR	33909697
MIRT732615	hsa-miR-214-3p	qRT-PCR	33909697
MIRT732616	hsa-miR-320a	qRT-PCR	33909697
MIRT732651	hsa-miR-205-5p	Immunohistochemistry (IHC), In situ hybridization, Microarray, qRT-PCR, Western blotting	31547870
MIRT781426	hsa-miR-1224-3p	CLIP-seq
MIRT781427	hsa-miR-125a-3p	CLIP-seq
MIRT781428	hsa-miR-1267	CLIP-seq
MIRT781429	hsa-miR-1273f	CLIP-seq
MIRT781430	hsa-miR-1289	CLIP-seq
MIRT781431	hsa-miR-129-5p	CLIP-seq
MIRT781432	hsa-miR-1303	CLIP-seq
MIRT781433	hsa-miR-135a	CLIP-seq
MIRT781434	hsa-miR-135b	CLIP-seq
MIRT781435	hsa-miR-143	CLIP-seq
MIRT781436	hsa-miR-148a	CLIP-seq
MIRT781437	hsa-miR-148b	CLIP-seq
MIRT781438	hsa-miR-152	CLIP-seq
MIRT781439	hsa-miR-1913	CLIP-seq
MIRT781440	hsa-miR-197	CLIP-seq
MIRT781441	hsa-miR-198	CLIP-seq
MIRT781442	hsa-miR-3164	CLIP-seq
MIRT781443	hsa-miR-3194-3p	CLIP-seq
MIRT781444	hsa-miR-3198	CLIP-seq
MIRT781445	hsa-miR-324-3p	CLIP-seq
MIRT781446	hsa-miR-3545-3p	CLIP-seq
MIRT781447	hsa-miR-3662	CLIP-seq
MIRT781448	hsa-miR-3663-5p	CLIP-seq
MIRT781449	hsa-miR-378g	CLIP-seq
MIRT781450	hsa-miR-3934	CLIP-seq
MIRT781451	hsa-miR-4276	CLIP-seq
MIRT781452	hsa-miR-4294	CLIP-seq
MIRT781453	hsa-miR-4309	CLIP-seq
MIRT781454	hsa-miR-431	CLIP-seq
MIRT781455	hsa-miR-4326	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT781457	hsa-miR-448	CLIP-seq
MIRT781458	hsa-miR-4527	CLIP-seq
MIRT781459	hsa-miR-4534	CLIP-seq
MIRT781460	hsa-miR-4635	CLIP-seq
MIRT781461	hsa-miR-4645-5p	CLIP-seq
MIRT781462	hsa-miR-4659a-3p	CLIP-seq
MIRT781463	hsa-miR-4659b-3p	CLIP-seq
MIRT781464	hsa-miR-4673	CLIP-seq
MIRT781465	hsa-miR-4680-5p	CLIP-seq
MIRT781466	hsa-miR-4707-5p	CLIP-seq
MIRT781467	hsa-miR-4708-5p	CLIP-seq
MIRT781468	hsa-miR-4716-5p	CLIP-seq
MIRT781469	hsa-miR-4720-3p	CLIP-seq
MIRT781470	hsa-miR-4770	CLIP-seq
MIRT781471	hsa-miR-5096	CLIP-seq
MIRT781472	hsa-miR-764	CLIP-seq
MIRT781473	hsa-miR-924	CLIP-seq
MIRT1930639	hsa-miR-122	CLIP-seq
MIRT1930640	hsa-miR-3135b	CLIP-seq
MIRT1930641	hsa-miR-3150a-3p	CLIP-seq
MIRT1930642	hsa-miR-3175	CLIP-seq
MIRT1930643	hsa-miR-3652	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT1930644	hsa-miR-4430	CLIP-seq
MIRT1930645	hsa-miR-4434	CLIP-seq
MIRT1930646	hsa-miR-4466	CLIP-seq
MIRT1930647	hsa-miR-4516	CLIP-seq
MIRT781466	hsa-miR-4707-5p	CLIP-seq
MIRT1930648	hsa-miR-491-5p	CLIP-seq
MIRT1930649	hsa-miR-541	CLIP-seq
MIRT1930650	hsa-miR-598	CLIP-seq
MIRT1930651	hsa-miR-654-5p	CLIP-seq
MIRT1930652	hsa-miR-675	CLIP-seq
MIRT1930653	hsa-miR-939	CLIP-seq
MIRT1930654	hsa-miR-4539	CLIP-seq
MIRT1930655	hsa-miR-4652-3p	CLIP-seq
MIRT1930655	hsa-miR-4652-3p	CLIP-seq
MIRT781469	hsa-miR-4720-3p	CLIP-seq
MIRT2171267	hsa-miR-4775	CLIP-seq
MIRT1930639	hsa-miR-122	CLIP-seq
MIRT781428	hsa-miR-1267	CLIP-seq
MIRT781430	hsa-miR-1289	CLIP-seq
MIRT2171268	hsa-miR-24	CLIP-seq
MIRT1930640	hsa-miR-3135b	CLIP-seq
MIRT781443	hsa-miR-3194-3p	CLIP-seq
MIRT781444	hsa-miR-3198	CLIP-seq
MIRT781446	hsa-miR-3545-3p	CLIP-seq
MIRT1930643	hsa-miR-3652	CLIP-seq
MIRT2171269	hsa-miR-4284	CLIP-seq
MIRT2171270	hsa-miR-4287	CLIP-seq
MIRT781452	hsa-miR-4294	CLIP-seq
MIRT781453	hsa-miR-4309	CLIP-seq
MIRT781454	hsa-miR-431	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT1930644	hsa-miR-4430	CLIP-seq
MIRT1930646	hsa-miR-4466	CLIP-seq
MIRT2171271	hsa-miR-4469	CLIP-seq
MIRT781459	hsa-miR-4534	CLIP-seq
MIRT2171272	hsa-miR-4685-3p	CLIP-seq
MIRT781466	hsa-miR-4707-5p	CLIP-seq
MIRT2171273	hsa-miR-4713-5p	CLIP-seq
MIRT2171274	hsa-miR-4740-3p	CLIP-seq
MIRT2171275	hsa-miR-4772-3p	CLIP-seq
MIRT1930652	hsa-miR-675	CLIP-seq
MIRT781473	hsa-miR-924	CLIP-seq
MIRT2473926	hsa-miR-181a	CLIP-seq
MIRT2473927	hsa-miR-181b	CLIP-seq
MIRT2473928	hsa-miR-181c	CLIP-seq
MIRT2473929	hsa-miR-181d	CLIP-seq
MIRT2473930	hsa-miR-27a	CLIP-seq
MIRT2473931	hsa-miR-27b	CLIP-seq
MIRT2473932	hsa-miR-3591-3p	CLIP-seq
MIRT2473933	hsa-miR-3617	CLIP-seq
MIRT2473934	hsa-miR-4262	CLIP-seq
MIRT2171270	hsa-miR-4287	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT2171271	hsa-miR-4469	CLIP-seq
MIRT2473935	hsa-miR-452	CLIP-seq
MIRT2473936	hsa-miR-4676-3p	CLIP-seq
MIRT2171272	hsa-miR-4685-3p	CLIP-seq
MIRT2171273	hsa-miR-4713-5p	CLIP-seq
MIRT2473937	hsa-miR-513a-5p	CLIP-seq
MIRT2473938	hsa-miR-641	CLIP-seq
MIRT2171270	hsa-miR-4287	CLIP-seq
MIRT2171271	hsa-miR-4469	CLIP-seq
MIRT2473935	hsa-miR-452	CLIP-seq
MIRT2473936	hsa-miR-4676-3p	CLIP-seq
MIRT2171272	hsa-miR-4685-3p	CLIP-seq
MIRT2171273	hsa-miR-4713-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Activation	15003510
ETS2	Activation	15003510
FOXC2	Unknown	20213583
FOXO1	Unknown	20213583
GATA2	Unknown	22792348
LMO2	Unknown	22792348
LYL1	Unknown	22792348
TAL1	Unknown	22792348
VHL	Repression	12434420

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9204896, 10766762
GO:0005515	Function	Protein binding	IPI	15893672, 16732286, 20708158
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10218485
GO:0005615	Component	Extracellular space	IDA	9660821
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10766762
GO:0007165	Process	Signal transduction	TAS	10766762
GO:0007281	Process	Germ cell development	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010467	Process	Gene expression	IDA	28179430
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	19922791
GO:0031012	Component	Extracellular matrix	IBA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	9660821
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048014	Process	Tie signaling pathway	IBA
GO:0048014	Process	Tie signaling pathway	IDA	19922791
GO:0048018	Function	Receptor ligand activity	IDA	29323190
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0050820	Process	Positive regulation of coagulation	IDA	29323190
GO:0050928	Process	Negative regulation of positive chemotaxis	IDA	9660821
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0072012	Process	Glomerulus vasculature development	IEA
GO:0072012	Process	Glomerulus vasculature development	ISS

Other IDs

• MIM: 601922
• HGNC: 485
• e!Ensembl: ENSG00000091879

Protein

• UniProt ID: O15123
• Protein name: Angiopoietin-2 (ANG-2)
• Protein function: Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling (PubMed:15284220, PubMed:19116766, PubMed:19223473, PubMed:9204896). Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1 (PubMed:15284
• PDB: 1Z3S, 1Z3U, 2GY7, 4JZC, 4ZFG, 8VGP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00147	Fibrinogen_C	280 → 494	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Sequence:

  MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
  VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
  TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
  INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
  NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
  TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV
  SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
  NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
  GYSLKATTMMIRPADF

• Sequence length: 496

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Kaposi sarcoma-associated herpesvirus infection

Reactome:

Tie2 Signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Lymphatic malformation 10	Pathogenic	rs61733318, rs2129565840	RCV001479013 RCV001479014	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANGPT2-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE PRIMARY MICROCEPHALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPS FETALIS, NON-IMMUNE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY, PRIMARY AUTOSOMAL RECESSIVE, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31390228		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28208708, 28368336		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	31075757		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17785951		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17785951		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	17785951		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15501112		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28585908		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29724581		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14600132, 15094228, 31348822		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	24353325		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	25574809, 30994508		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	36435742	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	23421785	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	19120365		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21685330		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31001119		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31001119		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	27767064, 30943775		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	17828285, 20101091, 27283745, 27889204, 27912196, 28196857, 28434702, 28971841, 29158532, 29246140, 29273297, 29321388, 29800106, 29880489, 30054042, 30354818, 30580562, 30580570, 30642978, 30686087, 30871334, 31467666		★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	17828285		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21881497, 23176214, 26283334, 27246357, 27767064, 28445811, 28500604, 29369845, 29520165, 30181481, 30702576, 30994508, 31390228, 9257695		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22730375, 22864384, 28967470		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34691360	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12010571, 21858161, 29843785, 30745815	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12563678		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10506510, 11304469		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	30715101		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 1	Atelosteogenesis	Pubtator	24353325	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21881497, 23176214, 26283334, 27246357, 27767064, 28445811, 28500604, 29369845, 29520165, 30181481, 30702576, 30994508, 31390228, 9257695		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26283334, 30688091	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28639003, 30241939, 30370780, 30571551, 30636477, 31408621		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34794617	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	31797976		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	21367658, 28549782		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19120365, 23803577, 25776770, 29104621		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17928052		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28590830		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	24126820		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15517881, 19088043		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	27990590, 28368336, 29996658		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	32383346	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	34815366	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	31553988	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29431106		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	31795484	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	23232696		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10922985, 12010639, 17308086, 21680733, 22095586, 26272182, 28443023, 28534941, 29115538		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23232696, 25755760, 27353038, 28045923, 28062977, 31619709, 31642813, 34685578, 36008514, 39302921	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	31967847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11861279, 24404127	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15517881	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15517881, 20197469		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14600132, 14702352, 16830384, 17003480, 24045661, 29604220, 32183816, 32644941, 33647018, 34232180, 35987690, 36157115, 36308081, 37495746, 39746507	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	21948244	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15517881, 19088043		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17505039, 28906403, 29560103, 31281470		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33151982, 33173439	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37907568	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17505508, 24384875, 27100185	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25885021	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15517881	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12138242, 12810677, 15047239, 21439064, 28235714, 28898232		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	15581949		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	26801565	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36435742	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	9211178		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12963640, 9815151		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10505665, 11966404, 16705055, 20348331, 21147255, 22113528, 23117657, 23176214, 28292711, 28549782, 29369845, 30355236, 30707614, 31075757, 31319155, 31756341		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20348331, 23409162	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29431106		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	16565972	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29710550		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	30120397		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19341361, 19553662, 20599737, 26932603, 30120397		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	23176214, 26932603		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	24786777, 34153320	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20204292, 28584715, 28720059		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28584715, 28720059		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16465407		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24823366	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	29905392		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16565972		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30370780		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23176214, 26867059, 27846250, 28106663, 28333979, 29654395, 30354808, 30557359, 30608432		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29253494		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	17361220, 17928052		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17928052, 20670479, 23803577, 25030442, 25703238		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23305976		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30336268		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	12434420		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11571726		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17785951	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10568831, 14768007, 16525658, 25138435, 25374184, 28693205, 31173626, 31394786		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22728324	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24574808, 31929743, 33779485	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	17003480		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	28818232		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	27354285, 30744395, 30975293		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	24126820		★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	BEFREE	29534877		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20514436, 23337087, 26699387, 27354285, 28279521, 28381466, 28652105, 28679681, 28833476, 28848201, 28888034, 29113826, 29273297, 29664809, 30295643, 30355236, 30557359, 30840486, 31047008, 31756341, 9796075		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17505508, 24384875, 26115098		★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	26322922		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	12692304		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30295643, 30608432, 30702576, 31257664, 31617500		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17322632		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23392788, 30608432, 30702576, 31257664, 31617500		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34488330	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10908216, 30608432, 30702576, 31257664, 31617500		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	15187005, 28041961		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30050588		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12010571		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30612527		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31682000		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17359956, 20348331, 27612496, 28106663, 31756341		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28112754	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17359956, 20348331, 27612496, 28106663, 30414568, 31756341		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20348331, 23106921	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23421785	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35932065	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34762787	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35549955	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22811473		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29707992, 30414568		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	33909697	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36331122	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16527921, 16728425, 22113528, 22647632, 29642068, 30414568, 31118506		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	19238311, 26890140, 28508859, 29259905, 30002415		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23106921	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33683746, 34762787	Associate	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	19920349, 23685554, 29729633, 30333305, 30594664		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	29996658, 31140293		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	16538528		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	21367658, 28549782		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	20348331	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	35628389	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31682000		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	26945868		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12942123, 15581949, 17630849, 20204292, 29367076, 30863089		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18644593, 32908897	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15019822, 16723371, 29285116, 31547870		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16723371, 17141400		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18644593	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19324337	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	22606320, 34565297	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15047239, 28898232		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30484894		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36569220	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	3351294		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	26088137, 28192798, 28345626, 30668550, 30788433, 31513439		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30259536		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	17724803		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30336268, 31534314		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34036386	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	31320912		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	17724803		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	17724803	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	31292652		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31574535		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28920924		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11507079, 18991494, 20367336, 20501615, 28744448, 29644004, 30711932, 31597643, 9811337		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	9811337	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20501615, 27176932, 28744448, 29644004, 30711932, 31597643, 9811337		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10506510, 34815366, 37439825, 9811337	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11507079, 17704802, 30845704		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15743799, 16424009		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29846705	Stimulate	★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	31799395		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	7674591		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	18541195		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28122283		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	24728465, 28974565		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23337087, 27354285, 28279521, 28381466, 28652105, 28679681, 28833476, 28888034, 29113826, 29273297, 29664809, 30295643, 30355236, 30557359, 30840486, 31047008, 31756341		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30557359, 31047008, 31795484, 36435742	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	28041961		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	11733376, 16741507, 29427463, 31838054		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	10854238, 23558570, 25672915	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	17569031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematuria	Hematuria	Pubtator	33420149	Associate	★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	29427463		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23801605	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	26945868		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	20233519, 23383853, 27354285	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	26172478	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	17003480	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	20067780, 30744395		★☆☆☆☆ Found in Text Mining only
HETEROTAXY, VISCERAL, 2, AUTOSOMAL	Heterotaxy, Visceral	BEFREE	27773450		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30370780		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30370780		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	29382124		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	28106663		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19238311, 19273745, 22647632, 31828164		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31828164	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	26340459		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20348331	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	26801565, 34326408, 40512521	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	31339773		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11230310, 11451385, 11479256, 15753233, 17322151, 17703434, 17717147, 19841286, 19948988, 20100989, 20724906, 21147255, 21367658, 21394089, 24786777, 25767283, 26787451, 26801565, 27636897, 27881385, 27884223, 27889958, 27993561, 28034895, 28052870, 28060542, 28330983, 28338973, 28404593, 28447738, 28500604, 28587989, 28652105, 28659507, 28701311, 28814438, 29046315, 29118017, 29167122, 29167164, 29262411, 29360991, 29452567, 29668324, 29688896, 29729633, 29867533, 29939225, 30061705, 30120397, 30355236, 30395167, 30470661, 30478747, 30540685, 30572753, 30580687, 30612527, 30622158, 30636477, 30712424, 30739537, 30894089, 30898984, 30929511, 30929512, 30943068, 30958891, 30991833, 31011475, 31013256, 31015570, 31063551, 31183001, 31241148, 31352824, 31378107, 31378306, 31422690, 31507536, 31587572, 31735084, 31746626, 31756341, 31786979, 31787052, 9931107		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18382887		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	31217731		★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	Pubtator	37759728	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12213726	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14702352, 16242072, 26960364, 31340773, 33351148	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	16373885, 30036135, 30234375, 31599367		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21042788, 27492510		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	15458433		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29431106		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	31668109		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31173626		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	21778249		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28394321		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	28394321	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	34565297	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	11463715	Associate	★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	29448936		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	12963640		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24440367		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	20068079		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17483315, 22421142, 23536671, 28370338, 28750175		★☆☆☆☆ Found in Text Mining only
Kaposiform Hemangioendothelioma	Kaposiform Hemangioendothelioma	BEFREE	27990590		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21189404, 27636897, 28116710, 28413960, 28619367		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29654395		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29872039, 30141205, 30654408, 31512003		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29232407, 30612527		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17724803	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11840270		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24416201, 33284559	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16956819, 17904634, 17943167, 18483397, 24416201, 30555023		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17904634		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12698880, 12717391, 12808060, 14600132, 14607656, 15094228, 16629644, 16830384, 17003480, 17097688, 17167981, 17931370, 18924243, 25666192, 27556821, 27577856, 28592620, 29113912, 30259536, 30402928, 30701027, 31330833, 31367864, 9927494		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12717391, 16290311, 16629644, 16830384, 17167981, 17931370		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29604220	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30336268		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	33647018	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	14768007		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16525658		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20348277	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15375511, 17505039		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23587231	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36907878	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33420149	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33420149, 38162654	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	23137230		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17785951	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	20068079, 21685330		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37684509	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	22312192	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26088137	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31230885		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11507079		★☆☆☆☆ Found in Text Mining only
Malignant Hypertension	Malignant Hypertension	BEFREE	20724906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10922985, 12010639, 17308086, 21680733, 22095586, 22640261, 26272182, 28443023, 28534941, 29115538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20204292, 29367076, 30863089		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29253494		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17505039, 28906403, 29560103, 31281470		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12138242, 12810677, 21439064, 28235714		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21685330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17972146, 18184167, 18288685, 20583134, 20687230		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11280779, 15112366, 16185665, 16614513		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	18706742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15517881, 19088043		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10922985, 11280779, 12810677, 15517881, 16978237, 17513791, 17630849, 18483397, 19773447, 23643942, 26155940, 28693205, 28906403, 29560103, 30668550, 31069961, 31756341		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28584715, 28720059		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30445969		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17601353		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	20101091		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	33687603	Associate	★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	29046315		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23160899, 28404865, 28781670, 31069961		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35935946, 37240247	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	30120397		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30201261		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24834011		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20348331	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36055577	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20348331, 24819472, 29800106		★☆☆☆☆ Found in Text Mining only
MICROCEPHALY, PRIMARY AUTOSOMAL RECESSIVE, 1	Microcephaly	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	28918499	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	14556828		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	27381827, 30675657		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	36674749	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	27381827, 30675657		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	21905000		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23113684		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24355943	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28919108		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	27903510		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18483397, 21878936		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	28401709		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28222221, 28827845, 30050588, 30295643, 31645847, 9815151		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28889965, 30295643		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	30414568		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21819747		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36304979	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10506510, 11245414, 11280779, 11304469, 11305411, 11309342, 11380493, 11490375, 11507079, 11563986, 11571726, 11948116, 12698880, 12717391, 12808060, 12810677, 12831061, 14607656, 14768007, 15015569, 15094228, 15112366, 15307132, 15517881, 16525658, 16565972, 16618420, 16862184, 17440098, 17483315, 17505039, 17513791, 17704802, 17785951, 17931370, 17972146, 18706742, 19088043, 19773447, 20068079, 20197469, 20501615, 20530679, 20583134, 21233403, 21680733, 21728393, 22183643, 22327175, 22640261, 22777681, 23575268, 23643942, 23725836, 24587185, 25100134, 25138435, 25359494, 25374184, 25552591, 25703238, 25779598, 25977256, 26673168, 27353038, 27492854, 27554585, 28003187, 28043142, 28237867, 28370338, 28372817, 28387902, 28720059, 28750175, 28898232, 28906403, 29113912, 29118335, 29253494, 29397265, 29508855, 29560103, 30678135, 31173626, 31189647, 31394786, 31578584, 31617074, 9811337, 9927494		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	29746862		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30384404, 31352823		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	17724803		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22777681		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15501112, 20068079		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30259536		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15375511, 17505039, 23725836, 24587185, 26950275		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16705055, 21143167, 28474375		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23401397, 36055577	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	27581034		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27353038		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12010571	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	24966080		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30038058		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28108312		★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	18491423		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	21269615		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12138242, 12810677, 21439064, 28235714		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21439064, 31396019, 32878513, 33151982, 33713666, 37684509	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	28687961		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21685330, 21728393, 22457202		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37907568	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	15108186		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16712675		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31396803		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	30445969		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	24157526	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	24157526, 29618157		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29618157		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28791669		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29095861		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	11507079		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	17090781, 29597186, 29654395		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	22574900		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31063551		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31659187		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17972146, 18184167, 18288685, 20583134, 20687230		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30361641	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	33420149	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	28687961		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28027429		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	11348459, 34691360	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15743796, 30304544		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	25753570		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23305976	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26801565, 40512521	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	26590154	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29652517		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12434420, 24384875, 26115098, 27554585		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21189404, 27993561, 29728415, 29915018		★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	21189404		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	17828285		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	19271210, 27492510, 28455780, 28947844, 29477144, 30008611, 30171880, 30343317, 30537127, 30654408, 31822372		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10911358, 20689064, 30994508		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32329827	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	16877277, 18568888		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11838839, 12010571, 12563678, 17009243, 22730375, 26947206, 30745815		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28967470		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10854238	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15220918	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29925475, 31230885		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	39940697	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	14768007		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	20509945, 30286031, 30343317, 34153320	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18310225, 21531574, 22859861, 22890252, 23171759, 25748839, 28276491, 28294401, 28538018, 28746898, 29132435, 29413717, 29447449, 29571293, 29996658, 30286031, 31013257, 31489646, 31705327, 31726451, 31818332, 31822372		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33351148	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	27798093	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28474375		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17505039		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26268775	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27492854		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17697570		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24040410	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	15131005		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30259536		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15112366, 16185665		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15112366, 16338068, 16614513		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15112366, 16614513, 22449617, 25779598	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	31668109		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31075243		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15517881		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	33351148	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	27791295		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16360397		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10595926	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	16360397		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23232696		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15517881	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10766762	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	16009172, 8954043		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	10596910		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10880382, 24728465, 25172656, 28587989		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23801605, 32680471, 34526076	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	32582222	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	33608030, 35469796	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	30352204	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	31292652		★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	28818232		★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	10233502		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	10233502		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease	von Willebrand disorder	BEFREE	28362648, 29304535		★☆☆☆☆ Found in Text Mining only