MCHR1 (melanin concentrating hormone receptor 1)

Gene

• Entrez ID: 2847
• Gene name: Melanin concentrating hormone receptor 1
• Gene symbol: MCHR1
• Synonyms (NCBI Gene): GPR24, MCH-1R, MCH1R, SLC-1, SLC1
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1137137	hsa-miR-1207-5p	CLIP-seq
MIRT1137138	hsa-miR-1270	CLIP-seq
MIRT1137139	hsa-miR-1293	CLIP-seq
MIRT1137140	hsa-miR-146b-3p	CLIP-seq
MIRT1137141	hsa-miR-1909	CLIP-seq
MIRT1137142	hsa-miR-3173-5p	CLIP-seq
MIRT1137143	hsa-miR-3689d	CLIP-seq
MIRT1137144	hsa-miR-3944-5p	CLIP-seq
MIRT1137145	hsa-miR-432	CLIP-seq
MIRT1137146	hsa-miR-4443	CLIP-seq
MIRT1137147	hsa-miR-4483	CLIP-seq
MIRT1137148	hsa-miR-4683	CLIP-seq
MIRT1137149	hsa-miR-4732-3p	CLIP-seq
MIRT1137150	hsa-miR-4736	CLIP-seq
MIRT1137151	hsa-miR-4763-3p	CLIP-seq
MIRT1137152	hsa-miR-620	CLIP-seq
MIRT1137153	hsa-miR-874	CLIP-seq
MIRT1137154	hsa-miR-890	CLIP-seq
MIRT2039034	hsa-miR-3182	CLIP-seq
MIRT2039035	hsa-miR-4652-3p	CLIP-seq
MIRT2269056	hsa-miR-1178	CLIP-seq
MIRT1137140	hsa-miR-146b-3p	CLIP-seq
MIRT1137142	hsa-miR-3173-5p	CLIP-seq
MIRT1137143	hsa-miR-3689d	CLIP-seq
MIRT1137145	hsa-miR-432	CLIP-seq
MIRT1137146	hsa-miR-4443	CLIP-seq
MIRT1137149	hsa-miR-4732-3p	CLIP-seq
MIRT2269057	hsa-miR-483-3p	CLIP-seq
MIRT2269058	hsa-miR-508-5p	CLIP-seq
MIRT2269059	hsa-miR-766	CLIP-seq
MIRT1137153	hsa-miR-874	CLIP-seq
MIRT1137154	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10421367
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10421367
GO:0005929	Component	Cilium	IDA	28154160
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	10421367
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10421368
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	10421367
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	10421367
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007631	Process	Feeding behavior	TAS	10421367
GO:0008188	Function	Neuropeptide receptor activity	TAS	10860944
GO:0016020	Component	Membrane	IEA
GO:0030273	Function	Melanin-concentrating hormone receptor activity	IEA
GO:0042562	Function	Hormone binding	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0097730	Component	Non-motile cilium	IEA
GO:0097730	Component	Non-motile cilium	ISS

Other IDs

• MIM: 601751
• HGNC: 4479
• e!Ensembl: ENSG00000128285

Protein

• UniProt ID: Q99705
• Protein name: Melanin-concentrating hormone receptor 1 (MCH receptor 1) (MCH-R1) (MCHR-1) (G-protein coupled receptor 24) (MCH-1R) (MCH1R) (MCHR) (SLC-1) (Somatostatin receptor-like protein)
• Protein function: Receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.
• PDB: 8WSS, 8WWH, 8WWI, 8WWJ, 8WWK, 8WWL, 8WWM, 8WWN, 8YNT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	126 → 380	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highest level in brain, particularly in the frontal cortex and hypothalamus, lower levels in the liver and heart.
• Sequence:

  MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
  WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
  LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
  GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
  FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
  LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
  LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
  GT

• Sequence length: 422

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (i) signalling events
BBSome-mediated cargo-targeting to cilium

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MCHR1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	16603725		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	17655875		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17655875		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	22921745	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28867254		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl syndrome 3	Bardet-Biedl Syndrome	BEFREE	22139371		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16741940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16741940, 19502010		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	19502010	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32788609	Associate	★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	BEFREE	30149182		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39456726	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	16230605, 16934771, 17655875, 19182070, 22209364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	16934771, 17655875, 31376444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	16230605	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28808288		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28808288		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27986627		★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	31155350		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16741940		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28424515		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11708774		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	16230605, 16934771, 17655875, 19182070, 22209364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	16934771, 17655875, 31376444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	16741940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	16934771, 19418262		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16934771, 19418262		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	12379219, 16524757, 19540893		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28424515		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15166293, 18198296, 20054173, 21637341, 22921745, 24305679, 32329245	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15941924, 16033253, 16186414, 17655875, 18198296, 19418262, 20054173, 27320641, 27986627, 29948643		★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	20054173	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27844281		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23303587		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16741940, 19502010, 22081064, 31563948		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	16741940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16741940, 19502010, 22081064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19502010	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	34912333	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27986627		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	11927619, 14632194	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	14632194		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	14632194		★☆☆☆☆ Found in Text Mining only