IZUMO1 (izumo sperm-oocyte fusion 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 284359
• Gene name: Izumo sperm-oocyte fusion 1
• Gene symbol: IZUMO1
• Synonyms (NCBI Gene): IZUMO, OBF
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]).[supplied by OMIM, Mar 2008]

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000768	Process	Syncytium formation by plasma membrane fusion	ISS
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0002080	Component	Acrosomal membrane	IBA
GO:0002080	Component	Acrosomal membrane	IEA
GO:0002080	Component	Acrosomal membrane	ISS
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	24739963
GO:0005515	Function	Protein binding	IPI	27309808, 27309818
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15759005
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IC	15759005
GO:0007165	Process	Signal transduction	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IDA	15759005
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0016020	Component	Membrane	IDA	15759005
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034113	Process	Heterotypic cell-cell adhesion	IEA
GO:0035036	Process	Sperm-egg recognition	IBA
GO:0035036	Process	Sperm-egg recognition	IDA	39423812
GO:0035036	Process	Sperm-egg recognition	IEA
GO:0035036	Process	Sperm-egg recognition	ISS
GO:0042802	Function	Identical protein binding	IPI	27309808
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0048018	Function	Receptor ligand activity	ISS
GO:0086080	Function	Protein binding involved in heterotypic cell-cell adhesion	IBA
GO:0086080	Function	Protein binding involved in heterotypic cell-cell adhesion	ISS
GO:0098635	Component	Protein complex involved in cell-cell adhesion	ISS

Other IDs

• MIM: 609278
• HGNC: 28539
• e!Ensembl: ENSG00000182264

Protein

• UniProt ID: Q8IYV9
• Protein name: Izumo sperm-egg fusion protein 1 (Oocyte binding/fusion factor) (OBF) (Sperm-specific protein izumo)
• Protein function: Essential sperm cell-surface protein required for fertilization by acting as a ligand for IZUMO1R/JUNO receptor on egg. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization bu
• PDB: 5F4E , 5F4T , 5F4V , 5JK9 , 5JKC , 5JKD , 5JKE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15005	IZUMO	21 → 165	Izumo sperm-egg fusion, Ig domain-associated	Family
  PF16706	Izumo-Ig	168 → 255	Izumo-like Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Sperm-specific (at protein level) (PubMed:15759005, PubMed:36070373). Detectable on sperm surface only after the acrosome reaction (PubMed:15759005, PubMed:36070373). {ECO:0000269|PubMed:15759005, ECO:0000269|PubMed:36070373}.
• Sequence:

  MGPHFTLLCAALAGCLLPAEGCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENA
  VKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKE
  TFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMIL
  DCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNS
  SPATIINFHVTVLPKMIKEEKPSPNIVTPGEATTESSISLQPLQPEKMLASRLLGLLICG
  SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ

• Sequence length: 350

Pathways

Reactome Pathway:

Acrosome Reaction and Sperm:Oocyte Membrane Binding

Related Genes

No strongly related genes found yet for IZUMO1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IZUMO1.