LYPD5 (LY6/PLAUR domain containing 5)

Gene

• Entrez ID: 284348
• Gene name: LY6/PLAUR domain containing 5
• Gene symbol: LYPD5
• Synonyms (NCBI Gene): HALDISIN, PRO4356
• Chromosome: 19
• Chromosome location: 19q13.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019912	hsa-miR-375	Microarray	20215506
MIRT1123221	hsa-miR-1273d	CLIP-seq
MIRT1123222	hsa-miR-130a	CLIP-seq
MIRT1123223	hsa-miR-130b	CLIP-seq
MIRT1123224	hsa-miR-301a	CLIP-seq
MIRT1123225	hsa-miR-301b	CLIP-seq
MIRT1123226	hsa-miR-3126-5p	CLIP-seq
MIRT1123227	hsa-miR-3135b	CLIP-seq
MIRT1123228	hsa-miR-3657	CLIP-seq
MIRT1123229	hsa-miR-3666	CLIP-seq
MIRT1123230	hsa-miR-4252	CLIP-seq
MIRT1123231	hsa-miR-4295	CLIP-seq
MIRT1123232	hsa-miR-4433	CLIP-seq
MIRT1123233	hsa-miR-4487	CLIP-seq
MIRT1123234	hsa-miR-454	CLIP-seq
MIRT1123235	hsa-miR-4633-3p	CLIP-seq
MIRT1123236	hsa-miR-4640-5p	CLIP-seq
MIRT1123237	hsa-miR-4669	CLIP-seq
MIRT1123238	hsa-miR-4726-5p	CLIP-seq
MIRT1123239	hsa-miR-4753-5p	CLIP-seq
MIRT1123240	hsa-miR-3151	CLIP-seq
MIRT1123241	hsa-miR-3663-5p	CLIP-seq
MIRT1123242	hsa-miR-3677-3p	CLIP-seq
MIRT1123243	hsa-miR-4283	CLIP-seq
MIRT1123244	hsa-miR-4489	CLIP-seq
MIRT1123245	hsa-miR-4492	CLIP-seq
MIRT1123246	hsa-miR-4498	CLIP-seq
MIRT1123247	hsa-miR-4505	CLIP-seq
MIRT1123248	hsa-miR-4646-5p	CLIP-seq
MIRT1123249	hsa-miR-762	CLIP-seq
MIRT2265301	hsa-miR-1324	CLIP-seq
MIRT2265302	hsa-miR-181a	CLIP-seq
MIRT2265303	hsa-miR-181b	CLIP-seq
MIRT2265304	hsa-miR-181c	CLIP-seq
MIRT2265305	hsa-miR-181d	CLIP-seq
MIRT2265306	hsa-miR-4262	CLIP-seq
MIRT2265307	hsa-miR-4690-5p	CLIP-seq
MIRT2265308	hsa-miR-543	CLIP-seq
MIRT2684375	hsa-miR-1287	CLIP-seq
MIRT1123227	hsa-miR-3135b	CLIP-seq
MIRT1123233	hsa-miR-4487	CLIP-seq
MIRT1123235	hsa-miR-4633-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 619618
• HGNC: 26397
• e!Ensembl: ENSG00000159871

Protein

• UniProt ID: Q6UWN5
• Protein name: Ly6/PLAUR domain-containing protein 5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00021	UPAR_LY6	135 → 214	u-PAR/Ly-6 domain	Domain

• Sequence:

  MAMGVPRVILLCLFGAALCLTGSQALQCYSFEHTYFGPFDLRAMKLPSISCPHECFEAIL
  SLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPN
  LSQAPDPPTLSGAECYACIGVHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVY
  IRTCHRPSCTTEGTTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALL
  LPVLLLVGLSA

• Sequence length: 251

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	16733204, 24107548		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30268463		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	17671172, 17671180		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15358836, 16617102, 24413532, 28393842, 30642362		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	29377892	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20935042		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24107548, 27506865		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30631898		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30631898		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21617866		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20191297, 21448429, 23371285, 24884732		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28968973		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30659824		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17671180		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30979588		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16855396		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30558617	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27992674, 29042910, 29635894, 29654742		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27506865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15358836, 16617102, 24413532, 28393842, 30642362		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30979588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24107548, 27506865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21948970		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14871807, 23469203, 26214308, 28231399, 30463302, 31487842		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23265641, 28686969		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17105852, 21488078, 21555589, 21617866, 22253283, 26002011, 26093897, 26698569, 27127879, 28418887, 28570554, 30596107, 31783401		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	31552166		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30631898		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21617866		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16645043		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11764382		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29377892	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29024573		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28631568		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16511565, 18264140, 23343746, 23469203, 24107548, 27506865, 28589145, 29377892, 31487842, 31552166		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30321496		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20661085, 24107548, 24293376, 28418915		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24924175, 29805531		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21948970		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27044752		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14871807, 23469203, 26214308, 28231399, 30463302, 31487842		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31552166		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31783401		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23265641, 28686969		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	22305334		★☆☆☆☆ Found in Text Mining only