Gene Gene information from NCBI Gene database.
Entrez ID 284293
Gene name Histocompatibility minor serpin domain containing
Gene symbol HMSD
Synonyms (NCBI Gene)
ACC-6ACC6C18orf53HSMD-v
Chromosome 18
Chromosome location 18q22.1
Summary This gene encodes a serpin-domain containing protein that may function as a serine protease inhibitor. This gene is primarily expressed in cells of myeloid lineage. A polymorphism in this gene may result in the expression a splice variant that encodes a m
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0002253 Process Activation of immune response IDA 17409267
GO:0002253 Process Activation of immune response IMP 17409267
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612086 23037 ENSG00000221887
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MTL9
Protein name Serpin-like protein HMSD (Minor histocompatibility protein HMSD) (Minor histocompatibility serpin domain-containing protein)
Protein function Putative serine protease inhibitor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00079 Serpin 1 120 Serpin (serine protease inhibitor) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in dendritic cells and primary leukemia cells, especially those of myeloid lineage. {ECO:0000269|PubMed:17409267}.
Sequence
Sequence length 139
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7T4
Protein name Minor histocompatibility protein HMSD variant form (HSMD-v) [Cleaved into: Minor histocompatibility antigen ACC-6 (mHA ACC-6)]
Protein function This splice variant of HMSD is the precursor of the histocompatibility antigen ACC-6. More generally, minor histocompatibility antigens (mHags) refer to immunogenic peptide which, when complexed with MHC, can generate an immune response after re
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in dendritic cells and primary leukemia cells, especially those of myeloid lineage. ACC-6 expression is limited to cells of the hematopoietic lineage. {ECO:0000269|PubMed:17409267}.
Sequence
MEIFIEVFSHFLLQLTELTLNMCLELPTGSLEKSLMISSQVLQIPVANSTKQR
Sequence length 53
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATOPIC ECZEMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Agenesis of corpus callosum Agenesis Of Corpus Callosum BEFREE 21105967
★☆☆☆☆
Found in Text Mining only
Aplasia Cutis Congenita Aplasia Cutis Congenita BEFREE 21105967
★☆☆☆☆
Found in Text Mining only
Hematologic Neoplasms Hematologic Neoplasms BEFREE 17409267
★☆☆☆☆
Found in Text Mining only
Mucoepidermoid Carcinoma Mucoepidermoid Carcinoma BEFREE 21105967
★☆☆☆☆
Found in Text Mining only
PEELING SKIN SYNDROME 5 Peeling Skin Syndrome CLINVAR_DG
★☆☆☆☆
Found in Text Mining only