Gene Gene information from NCBI Gene database.
Entrez ID 284184
Gene name NADH:ubiquinone oxidoreductase complex assembly factor 8
Gene symbol NDUFAF8
Synonyms (NCBI Gene)
C17orf89MC1DN34
Chromosome 17
Chromosome location 17q25.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 27499296, 28514442, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 27499296
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618461 33551 ENSG00000224877
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A1L188
Protein name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8
Protein function Involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) (PubMed:27499296). Required to stabilize NDUFAF5 (PubMed:27499296).
Family and domains
Sequence
MSANGAVWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFEALRS
CFAAAAKKTLEGGC
Sequence length 74
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Thermogenesis  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Mitochondrial complex I deficiency, nuclear type 34 Pathogenic; Likely pathogenic rs1318084629, rs1598367619, rs1598368033, rs745332456 RCV002253062
RCV001003492
RCV001003491
RCV001003493
RCV001003490
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mitochondrial disease Pathogenic; Likely pathogenic rs1318084629, rs1598367619, rs1598368033, rs745332456 RCV000984081
RCV000984082
RCV000984079
RCV000984080
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NDUFAF8-related disorder Likely pathogenic; Pathogenic rs745332456 RCV004754579
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Gastric cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LEIGH SYNDROME ClinGen, GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Frontotemporal dementia Frontotemporal dementia GWASCAT_DG 26154020
★☆☆☆☆
Found in Text Mining only
Isolated complex I deficiency Isolated Complex I Deficiency Orphanet
★☆☆☆☆
Found in Text Mining only
Leigh Disease Leigh syndrome Pubtator 31866046 Associate
★☆☆☆☆
Found in Text Mining only
Mitochondrial complex I deficiency Mitochondrial complex deficiency Pubtator 31866046 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations