Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	284131
Gene name	Endonuclease V
Gene symbol	ENDOV
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q25.3

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments
MIRT963438	hsa-miR-1273d	CLIP-seq
MIRT963439	hsa-miR-15a	CLIP-seq
MIRT963440	hsa-miR-15b	CLIP-seq
MIRT963441	hsa-miR-16	CLIP-seq
MIRT963442	hsa-miR-181a	CLIP-seq
MIRT963443	hsa-miR-181b	CLIP-seq
MIRT963444	hsa-miR-181c	CLIP-seq
MIRT963445	hsa-miR-181d	CLIP-seq
MIRT963446	hsa-miR-193a-3p	CLIP-seq
MIRT963447	hsa-miR-193b	CLIP-seq
MIRT963448	hsa-miR-194	CLIP-seq
MIRT963449	hsa-miR-195	CLIP-seq
MIRT963450	hsa-miR-214	CLIP-seq
MIRT963451	hsa-miR-23a	CLIP-seq
MIRT963452	hsa-miR-23b	CLIP-seq
MIRT963453	hsa-miR-23c	CLIP-seq
MIRT963454	hsa-miR-300	CLIP-seq
MIRT963455	hsa-miR-3127-3p	CLIP-seq
MIRT963456	hsa-miR-3128	CLIP-seq
MIRT963457	hsa-miR-3591-3p	CLIP-seq
MIRT963458	hsa-miR-3619-5p	CLIP-seq
MIRT963459	hsa-miR-3647-3p	CLIP-seq
MIRT963460	hsa-miR-3685	CLIP-seq
MIRT963461	hsa-miR-381	CLIP-seq
MIRT963462	hsa-miR-384	CLIP-seq
MIRT963463	hsa-miR-409-5p	CLIP-seq
MIRT963464	hsa-miR-424	CLIP-seq
MIRT963465	hsa-miR-4262	CLIP-seq
MIRT963466	hsa-miR-4281	CLIP-seq
MIRT963467	hsa-miR-4291	CLIP-seq
MIRT963468	hsa-miR-4470	CLIP-seq
MIRT963469	hsa-miR-4694-3p	CLIP-seq
MIRT963470	hsa-miR-4705	CLIP-seq
MIRT963471	hsa-miR-497	CLIP-seq
MIRT963472	hsa-miR-522	CLIP-seq
MIRT963473	hsa-miR-761	CLIP-seq
MIRT963474	hsa-miR-892b	CLIP-seq
MIRT963475	hsa-miR-922	CLIP-seq
MIRT1985574	hsa-miR-1303	CLIP-seq
MIRT963457	hsa-miR-3591-3p	CLIP-seq
MIRT1985575	hsa-miR-4422	CLIP-seq
MIRT1985576	hsa-miR-4668-3p	CLIP-seq
MIRT1985577	hsa-miR-514	CLIP-seq
MIRT1985578	hsa-miR-514b-3p	CLIP-seq
MIRT2387412	hsa-miR-2110	CLIP-seq
MIRT2387413	hsa-miR-3064-5p	CLIP-seq
MIRT2387414	hsa-miR-3150a-3p	CLIP-seq
MIRT2387415	hsa-miR-3175	CLIP-seq
MIRT2387416	hsa-miR-342-5p	CLIP-seq
MIRT2387417	hsa-miR-4260	CLIP-seq
MIRT2387418	hsa-miR-4664-5p	CLIP-seq
MIRT2387419	hsa-miR-4728-5p	CLIP-seq
MIRT2387420	hsa-miR-939	CLIP-seq
MIRT2448837	hsa-miR-1200	CLIP-seq
MIRT2448838	hsa-miR-1253	CLIP-seq
MIRT2448839	hsa-miR-1276	CLIP-seq
MIRT2448840	hsa-miR-4251	CLIP-seq
MIRT2448841	hsa-miR-4324	CLIP-seq
MIRT2448842	hsa-miR-544b	CLIP-seq
MIRT2523825	hsa-miR-1245b-5p	CLIP-seq
MIRT2523826	hsa-miR-3142	CLIP-seq
MIRT2523827	hsa-miR-361-3p	CLIP-seq
MIRT2523828	hsa-miR-4650-5p	CLIP-seq
MIRT2523825	hsa-miR-1245b-5p	CLIP-seq
MIRT2523826	hsa-miR-3142	CLIP-seq
MIRT2523827	hsa-miR-361-3p	CLIP-seq
MIRT2523828	hsa-miR-4650-5p	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0000287	Function	Magnesium ion binding	TAS	23912683
GO:0003677	Function	DNA binding	IDA	23139746
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0003727	Function	Single-stranded RNA binding	IDA	23912683, 23912718
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	27573237
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	23139746, 31703097
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23139746, 23912718, 27573237, 31703097
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IEA
GO:0010494	Component	Cytoplasmic stress granule	IDA	27573237, 31703097
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0016888	Function	DNA endonuclease activity, producing 5'-phosphomonoesters	IDA	23139746, 23912683
GO:0016888	Function	DNA endonuclease activity, producing 5'-phosphomonoesters	ISS
GO:0016891	Function	RNA endonuclease activity producing 5'-phosphomonoesters, hydrolytic mechanism	IBA
GO:0016891	Function	RNA endonuclease activity producing 5'-phosphomonoesters, hydrolytic mechanism	IDA	3170309, 23912683, 23912718, 27573237
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
619821	26640	ENSG00000173818

Q8N8Q3

Protein name

Endonuclease V (hEndoV) (EC 3.1.26.-) (Inosine-specific endoribonuclease)

Protein function

[Isoform 1]: Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine (PubMed:23912683, PubMed:23912718, PubMed:25195743, PubMed:27573237, PubMed:31703097). Active against bo

PDB

4NSP , 6OZE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04493	Endonuclease_5	23 → 241	Endonuclease V	Domain

Sequence

MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGGVDVSFVKGDS
VRACASLVVLSFPELEVVYEESRMVSLTAPYVSGFLAFREVPFLLELVQQLREKEPGLMP
QVLLVDGNGVLHHRGFGVACHLGVLTDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRG
DSFPLLGDSGTVLGMALRSHDRSTRPLYISVGHRMSLEAAVRLTCCCCRFRIPEPVRQAD
ICSREHIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSALC

Sequence length

282

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UMLS: C0007644	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	15603216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25053281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	9372849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11896624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	29223016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15603216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25053281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11809366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	2918866, 3014326, 8386177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group B	Xeroderma pigmentosum	Pubtator	7479008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ENDOV (endonuclease V)