Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	284129
Gene name	Solute carrier family 26 member 11
Gene symbol	SLC26A11
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q25.3
Summary	This gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family of proteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance. The encoded protein is a s

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments
MIRT1357467	hsa-miR-1228	CLIP-seq
MIRT1357468	hsa-miR-329	CLIP-seq
MIRT1357469	hsa-miR-362-3p	CLIP-seq
MIRT1357470	hsa-miR-514	CLIP-seq
MIRT1357471	hsa-miR-514b-3p	CLIP-seq
MIRT1357472	hsa-miR-579	CLIP-seq
MIRT1357473	hsa-miR-598	CLIP-seq
MIRT1357474	hsa-miR-642b	CLIP-seq
MIRT1357475	hsa-miR-30a	CLIP-seq
MIRT1357476	hsa-miR-30b	CLIP-seq
MIRT1357477	hsa-miR-30c	CLIP-seq
MIRT1357478	hsa-miR-30d	CLIP-seq
MIRT1357479	hsa-miR-30e	CLIP-seq
MIRT1357480	hsa-miR-3163	CLIP-seq
MIRT1357481	hsa-miR-3607-3p	CLIP-seq
MIRT1357482	hsa-miR-3662	CLIP-seq
MIRT1357483	hsa-miR-3668	CLIP-seq
MIRT1357484	hsa-miR-3924	CLIP-seq
MIRT1357485	hsa-miR-4729	CLIP-seq
MIRT1357486	hsa-miR-568	CLIP-seq
MIRT1357487	hsa-miR-603	CLIP-seq
MIRT1357488	hsa-miR-767-5p	CLIP-seq
MIRT2330337	hsa-miR-3615	CLIP-seq
MIRT2330338	hsa-miR-3917	CLIP-seq
MIRT2330339	hsa-miR-4768-5p	CLIP-seq
MIRT2624395	hsa-miR-1	CLIP-seq
MIRT1357467	hsa-miR-1228	CLIP-seq
MIRT2624396	hsa-miR-1247	CLIP-seq
MIRT2624397	hsa-miR-1281	CLIP-seq
MIRT2624398	hsa-miR-1293	CLIP-seq
MIRT2624399	hsa-miR-1299	CLIP-seq
MIRT2624400	hsa-miR-1913	CLIP-seq
MIRT2624401	hsa-miR-1976	CLIP-seq
MIRT2624402	hsa-miR-206	CLIP-seq
MIRT2624403	hsa-miR-2110	CLIP-seq
MIRT2624404	hsa-miR-3138	CLIP-seq
MIRT2624405	hsa-miR-3150a-3p	CLIP-seq
MIRT2624406	hsa-miR-3154	CLIP-seq
MIRT2624407	hsa-miR-3166	CLIP-seq
MIRT2624408	hsa-miR-3175	CLIP-seq
MIRT2624409	hsa-miR-3184	CLIP-seq
MIRT2624410	hsa-miR-324-3p	CLIP-seq
MIRT1357468	hsa-miR-329	CLIP-seq
MIRT2330337	hsa-miR-3615	CLIP-seq
MIRT1357469	hsa-miR-362-3p	CLIP-seq
MIRT2624411	hsa-miR-3673	CLIP-seq
MIRT2330338	hsa-miR-3917	CLIP-seq
MIRT2624412	hsa-miR-423-5p	CLIP-seq
MIRT2624413	hsa-miR-4260	CLIP-seq
MIRT2624414	hsa-miR-4483	CLIP-seq
MIRT2624415	hsa-miR-4520a-3p	CLIP-seq
MIRT2624416	hsa-miR-4651	CLIP-seq
MIRT2624417	hsa-miR-4710	CLIP-seq
MIRT2624418	hsa-miR-4722-3p	CLIP-seq
MIRT2624419	hsa-miR-4728-5p	CLIP-seq
MIRT2624420	hsa-miR-4763-5p	CLIP-seq
MIRT2330339	hsa-miR-4768-5p	CLIP-seq
MIRT2624421	hsa-miR-4777-5p	CLIP-seq
MIRT2624422	hsa-miR-518d-5p	CLIP-seq
MIRT2624423	hsa-miR-519b-5p	CLIP-seq
MIRT2624424	hsa-miR-519c-5p	CLIP-seq
MIRT2624425	hsa-miR-520c-5p	CLIP-seq
MIRT2624426	hsa-miR-526a	CLIP-seq
MIRT2624427	hsa-miR-586	CLIP-seq
MIRT2624428	hsa-miR-608	CLIP-seq
MIRT2624429	hsa-miR-613	CLIP-seq
MIRT2624430	hsa-miR-616	CLIP-seq
MIRT2624431	hsa-miR-622	CLIP-seq
MIRT1357474	hsa-miR-642b	CLIP-seq
MIRT2624432	hsa-miR-875-3p	CLIP-seq
MIRT2624433	hsa-miR-939	CLIP-seq
MIRT2624399	hsa-miR-1299	CLIP-seq
MIRT2624403	hsa-miR-2110	CLIP-seq
MIRT2624405	hsa-miR-3150a-3p	CLIP-seq
MIRT2624406	hsa-miR-3154	CLIP-seq
MIRT2624408	hsa-miR-3175	CLIP-seq
MIRT2624413	hsa-miR-4260	CLIP-seq
MIRT2624419	hsa-miR-4728-5p	CLIP-seq
MIRT2624421	hsa-miR-4777-5p	CLIP-seq
MIRT2624422	hsa-miR-518d-5p	CLIP-seq
MIRT2624423	hsa-miR-519b-5p	CLIP-seq
MIRT2624424	hsa-miR-519c-5p	CLIP-seq
MIRT2624425	hsa-miR-520c-5p	CLIP-seq
MIRT2624426	hsa-miR-526a	CLIP-seq
MIRT2624427	hsa-miR-586	CLIP-seq
MIRT2624430	hsa-miR-616	CLIP-seq
MIRT2624431	hsa-miR-622	CLIP-seq
MIRT2624432	hsa-miR-875-3p	CLIP-seq
MIRT2624433	hsa-miR-939	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IEA
GO:0005254	Function	Chloride channel activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	20957757
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	12626430
GO:0005794	Component	Golgi apparatus	IDA	12626430
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12626430
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0008509	Function	Monoatomic anion transmembrane transporter activity	IDA	12626430
GO:0008509	Function	Monoatomic anion transmembrane transporter activity	IEA
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA
GO:0015116	Function	Sulfate transmembrane transporter activity	TAS
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IDA	12626430
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0019532	Process	Oxalate transport	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098661	Process	Inorganic anion transmembrane transport	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	ISS
GO:1902358	Process	Sulfate transmembrane transport	IBA
GO:1902358	Process	Sulfate transmembrane transport	IDA	12626430
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA

MIM	HGNC	e!Ensembl
610117	14471	ENSG00000181045

Q86WA9

Protein name

Sodium-independent sulfate anion transporter (Solute carrier family 26 member 11)

Protein function

Sodium-independent anion exchanger mediating bicarbonate, chloride, sulfate and oxalate transport (By similarity). Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate u

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	48 → 441	Sulfate permease family	Family
PF01740	STAS	470 → 576	STAS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in all tissues tested with highest expression observed in brain, kidney, HEVEC and placenta and lowest in pancreas, skeletal muscle, liver, lung and heart. {ECO:0000269|PubMed:11087667, ECO:0000269|PubMed:12626430}.

Sequence

MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGL
TAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIP
RPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLV
WAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT
EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPV
TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPV
LVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQ
KQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
VALLKA

Sequence length

606

Interactions

View interactions

	Reactome
			Multifunctional anion exchangers

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOPOLYSACCHARIDOSIS III	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOPOLYSACCHARIDOSIS TYPE IIIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	37511575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26732560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	CLINVAR_DG	21910976, 22976768, 24816101		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23151810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35568949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC26A11 (solute carrier family 26 member 11)