Gene Gene information from NCBI Gene database.
Entrez ID 284106
Gene name CDGSH iron sulfur domain 3
Gene symbol CISD3
Synonyms (NCBI Gene)
MiNTMiner2
Chromosome 17
Chromosome location 17q12
Summary CISD3 is a member of the CDGSH domain-containing family, which may play a role in regulating electron transport and oxidative phosphorylation (Wiley et al., 2007 [PubMed 17376863]).[supplied by OMIM, Apr 2008]
miRNA miRNA information provided by mirtarbase database.
462
miRTarBase ID miRNA Experiments Reference
MIRT615087 hsa-miR-1914-5p HITS-CLIP 23824327
MIRT615086 hsa-miR-2682-3p HITS-CLIP 23824327
MIRT615085 hsa-miR-6781-3p HITS-CLIP 23824327
MIRT615084 hsa-miR-6867-5p HITS-CLIP 23824327
MIRT615082 hsa-miR-5001-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 17376863
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611933 27578 ENSG00000277972
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7P0
Protein name CDGSH iron-sulfur domain-containing protein 3, mitochondrial (MitoNEET-related protein 2) (Miner2) (Mitochondrial inner NEET protein) (MiNT)
Protein function Can transfer its iron-sulfur clusters to the apoferrodoxins FDX1 and FDX2. Contributes to mitochondrial iron homeostasis and in maintaining normal levels of free iron and reactive oxygen species, and thereby contributes to normal mitochondrial f
PDB 6AVJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09360 zf-CDGSH 38 76 Iron-binding zinc finger CDGSH type Domain
PF09360 zf-CDGSH 81 114 Iron-binding zinc finger CDGSH type Domain
Sequence
MRGAGAILRPAARGARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWC
VCGRSKKQPFCDGSHF
FQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQK
AEVGSPL
Sequence length 127
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
TURNPENNY-FRY SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
WOLFRAM SYNDROME 2 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 18451217
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular disease Pubtator 29556009 Associate
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic Neoplasms BEFREE 18767147
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 12414620, 17474983
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes mellitus Pubtator 29556009 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 28082676 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 28082676
★☆☆☆☆
Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer Colorectal Cancer BEFREE 15340260
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 19787262, 22407776
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of urinary bladder Urinary bladder cancer BEFREE 17079487
★☆☆☆☆
Found in Text Mining only