Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	284076
Gene name	Tubulin tyrosine ligase like 6
Gene symbol	TTLL6
Synonyms (NCBI Gene)	TTL.6
Chromosome	17
Chromosome location	17q21.32

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments
MIRT2359822	hsa-miR-141	CLIP-seq
MIRT2359823	hsa-miR-200a	CLIP-seq
MIRT2359824	hsa-miR-4677-3p	CLIP-seq
MIRT2359825	hsa-miR-4679	CLIP-seq
MIRT2359826	hsa-miR-4778-5p	CLIP-seq
MIRT2442778	hsa-miR-1226	CLIP-seq
MIRT2442779	hsa-miR-1321	CLIP-seq
MIRT2442780	hsa-miR-138	CLIP-seq
MIRT2442781	hsa-miR-1587	CLIP-seq
MIRT2442782	hsa-miR-3126-5p	CLIP-seq
MIRT2442783	hsa-miR-4299	CLIP-seq
MIRT2442784	hsa-miR-4419a	CLIP-seq
MIRT2442785	hsa-miR-4492	CLIP-seq
MIRT2442786	hsa-miR-4498	CLIP-seq
MIRT2442787	hsa-miR-4510	CLIP-seq
MIRT2442788	hsa-miR-4656	CLIP-seq
MIRT2442789	hsa-miR-4675	CLIP-seq
MIRT2442790	hsa-miR-4710	CLIP-seq
MIRT2442791	hsa-miR-4733-3p	CLIP-seq
MIRT2442792	hsa-miR-4739	CLIP-seq
MIRT2442793	hsa-miR-4741	CLIP-seq
MIRT2442794	hsa-miR-4756-5p	CLIP-seq
MIRT2442795	hsa-miR-4792	CLIP-seq
MIRT2442796	hsa-miR-762	CLIP-seq
MIRT2653108	hsa-miR-1207-5p	CLIP-seq
MIRT2653109	hsa-miR-1827	CLIP-seq
MIRT2653110	hsa-miR-3189-5p	CLIP-seq
MIRT2653111	hsa-miR-328	CLIP-seq
MIRT2653112	hsa-miR-4446-3p	CLIP-seq
MIRT2442789	hsa-miR-4675	CLIP-seq
MIRT2653113	hsa-miR-4687-3p	CLIP-seq
MIRT2442793	hsa-miR-4741	CLIP-seq
MIRT2653114	hsa-miR-4763-3p	CLIP-seq
MIRT2653115	hsa-miR-940	CLIP-seq
MIRT2653108	hsa-miR-1207-5p	CLIP-seq
MIRT2653109	hsa-miR-1827	CLIP-seq
MIRT2653110	hsa-miR-3189-5p	CLIP-seq
MIRT2653111	hsa-miR-328	CLIP-seq
MIRT2653112	hsa-miR-4446-3p	CLIP-seq
MIRT2442789	hsa-miR-4675	CLIP-seq
MIRT2653113	hsa-miR-4687-3p	CLIP-seq
MIRT2442793	hsa-miR-4741	CLIP-seq
MIRT2653114	hsa-miR-4763-3p	CLIP-seq
MIRT2653115	hsa-miR-940	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001578	Process	Microtubule bundle formation	IBA
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0003353	Process	Positive regulation of cilium movement	IEA
GO:0005515	Function	Protein binding	IPI	22246503
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IDA
GO:0005929	Component	Cilium	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0015631	Function	Tubulin binding	IBA
GO:0015631	Function	Tubulin binding	IEA
GO:0015631	Function	Tubulin binding	ISS
GO:0016874	Function	Ligase activity	IEA
GO:0018095	Process	Protein polyglutamylation	ISS
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IDA	22246503
GO:0036064	Component	Ciliary basal body	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051013	Process	Microtubule severing	IEA
GO:0060296	Process	Regulation of cilium beat frequency involved in ciliary motility	IEA
GO:0060296	Process	Regulation of cilium beat frequency involved in ciliary motility	ISS
GO:0070739	Function	Protein-glutamic acid ligase activity	IEA
GO:0070739	Function	Protein-glutamic acid ligase activity	ISS
GO:0070740	Function	Tubulin-glutamic acid ligase activity	IBA
GO:0070740	Function	Tubulin-glutamic acid ligase activity	IEA
GO:0070740	Function	Tubulin-glutamic acid ligase activity	ISS
GO:0070740	Function	Tubulin-glutamic acid ligase activity	TAS
GO:0097731	Component	9+0 non-motile cilium	IEA
GO:0106437	Function	Protein-glutamic acid ligase activity, initiating	IEA
GO:0106438	Function	Protein-glutamic acid ligase activity, elongating	IEA

MIM	HGNC	e!Ensembl
610849	26664	ENSG00000170703

Q8N841

Protein name

Tubulin polyglutamylase TTLL6 (EC 6.3.2.-) (Protein polyglutamylase TTLL6) (Tubulin--tyrosine ligase-like protein 6)

Protein function

Polyglutamylase which modifies both tubulin and non-tubulin proteins, generating alpha-linked polyglutamate side chains on the gamma-carboxyl group of specific glutamate residues of target proteins. Preferentially mediates ATP-dependent long pol

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03133	TTL	104 → 398	Tubulin-tyrosine ligase family	Family

Sequence

MPQCPTLESQEGENSEEKGDSSKEDPKETVALAFVRENPGAQNGLQNAQQQGKKKRKKKR
LVINLSSCRYESVRRAAQQYGFREGGEDDDWTLYWTDYSVSLERVMEMKSYQKINHFPGM
SEICRKDLLARNMSRMLKMFPKDFRFFPRTWCLPADWGDLQTYSRSRKNKTYICKPDSGC
QGKGIFITRTVKEIKPGEDMICQLYISKPFIIDGFKFDLRIYVLVTSCDPLRIFVYNEGL
ARFATTSYSRPCTDNLDDICMHLTNYSINKHSSNFSRDAHSGSKRKLSTFSAYLEDHSYN
VEQIWRDIEDVIIKTLISAHPIIRHNYHTCFPNHTLNSACFEILGFDILLDHKLKPWLLE
VNHSPSFSTDSRLDKEVKDGLLYDTLVLINLESCDKKKVLEEERQRGQFLQQCCSREMRI
EEAKGFRAVQLKKTETYEKENCGGFRLIYPSLNSEKYEKFFQDNNSLFQNTVASRAREEY
ARQLIQELRLKREKKPFQMKKKVEMQGESAGEQVRKKGMRGWQQKQQQKDKAATQASKQY
IQPLTLVSYTPDLLLSVRGERKNETDSSLNQEAPTEEASSVFPKLTSAKPFSSLPDLRNI
NLSSSKLEPSKPNFSIKEAKSASAVNVFTGTVHLTSVETTPESTTQLSISPKSPPTLAVT
ASSEYSGPETDRVVSFKCKKQQTPPHLTQKKMLKSFLPTKSKSFWESPNTNWTLLKSDMN
KPHLISELLTKLQLSGKLSFFPAHYNPKLGMNNLSQNPSLPGECHSRSDSSGEKRQLDVS
SLLLQSPQSYNVTLRDLLVIATPAQLDPRPCRSHASAMRDPCMQDQEAYSHCLISGQKGC
ERS

Sequence length

843

Interactions

View interactions

	Reactome
			Carboxyterminal post-translational modifications of tubulin

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	24280982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30956117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29632382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30956117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	GWASDB_DG	24280982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	GWASDB_DG	24280982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	24280982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TTLL6 (tubulin tyrosine ligase like 6)