Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	284021
Gene name	Mast cell immunoglobulin like receptor 1
Gene symbol	MILR1
Synonyms (NCBI Gene)	Allergin-1C17orf60MCA-32MCA32
Chromosome	17
Chromosome location	17q23.3

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments
MIRT1149156	hsa-miR-1273f	CLIP-seq
MIRT1149157	hsa-miR-143	CLIP-seq
MIRT1149158	hsa-miR-1827	CLIP-seq
MIRT1149159	hsa-miR-3122	CLIP-seq
MIRT1149160	hsa-miR-3200-5p	CLIP-seq
MIRT1149161	hsa-miR-338-3p	CLIP-seq
MIRT1149162	hsa-miR-3606	CLIP-seq
MIRT1149163	hsa-miR-3607-3p	CLIP-seq
MIRT1149164	hsa-miR-3686	CLIP-seq
MIRT1149165	hsa-miR-3689a-3p	CLIP-seq
MIRT1149166	hsa-miR-3689c	CLIP-seq
MIRT1149167	hsa-miR-3913-5p	CLIP-seq
MIRT1149168	hsa-miR-4324	CLIP-seq
MIRT1149169	hsa-miR-4433	CLIP-seq
MIRT1149170	hsa-miR-4459	CLIP-seq
MIRT1149171	hsa-miR-4514	CLIP-seq
MIRT1149172	hsa-miR-4530	CLIP-seq
MIRT1149173	hsa-miR-4649-3p	CLIP-seq
MIRT1149174	hsa-miR-4652-3p	CLIP-seq
MIRT1149175	hsa-miR-4692	CLIP-seq
MIRT1149176	hsa-miR-4701-5p	CLIP-seq
MIRT1149177	hsa-miR-4703-3p	CLIP-seq
MIRT1149178	hsa-miR-4708-5p	CLIP-seq
MIRT1149179	hsa-miR-4728-5p	CLIP-seq
MIRT1149180	hsa-miR-4768-3p	CLIP-seq
MIRT1149181	hsa-miR-4770	CLIP-seq
MIRT1149182	hsa-miR-588	CLIP-seq
MIRT1149183	hsa-miR-940	CLIP-seq
MIRT1149158	hsa-miR-1827	CLIP-seq
MIRT2042439	hsa-miR-3127-5p	CLIP-seq
MIRT1149160	hsa-miR-3200-5p	CLIP-seq
MIRT2042440	hsa-miR-3918	CLIP-seq
MIRT1149171	hsa-miR-4514	CLIP-seq
MIRT1149173	hsa-miR-4649-3p	CLIP-seq
MIRT1149175	hsa-miR-4692	CLIP-seq
MIRT1149183	hsa-miR-940	CLIP-seq
MIRT1149158	hsa-miR-1827	CLIP-seq
MIRT2272060	hsa-miR-24	CLIP-seq
MIRT1149159	hsa-miR-3122	CLIP-seq
MIRT2042439	hsa-miR-3127-5p	CLIP-seq
MIRT2272061	hsa-miR-3155	CLIP-seq
MIRT2272062	hsa-miR-3155b	CLIP-seq
MIRT1149160	hsa-miR-3200-5p	CLIP-seq
MIRT1149161	hsa-miR-338-3p	CLIP-seq
MIRT1149165	hsa-miR-3689a-3p	CLIP-seq
MIRT1149166	hsa-miR-3689c	CLIP-seq
MIRT1149167	hsa-miR-3913-5p	CLIP-seq
MIRT2042440	hsa-miR-3918	CLIP-seq
MIRT2272063	hsa-miR-4284	CLIP-seq
MIRT1149169	hsa-miR-4433	CLIP-seq
MIRT1149170	hsa-miR-4459	CLIP-seq
MIRT1149171	hsa-miR-4514	CLIP-seq
MIRT1149172	hsa-miR-4530	CLIP-seq
MIRT1149173	hsa-miR-4649-3p	CLIP-seq
MIRT1149175	hsa-miR-4692	CLIP-seq
MIRT1149176	hsa-miR-4701-5p	CLIP-seq
MIRT1149177	hsa-miR-4703-3p	CLIP-seq
MIRT1149179	hsa-miR-4728-5p	CLIP-seq
MIRT1149180	hsa-miR-4768-3p	CLIP-seq
MIRT2272064	hsa-miR-484	CLIP-seq
MIRT2272065	hsa-miR-564	CLIP-seq
MIRT1149182	hsa-miR-588	CLIP-seq
MIRT1149183	hsa-miR-940	CLIP-seq
MIRT1149158	hsa-miR-1827	CLIP-seq
MIRT1149159	hsa-miR-3122	CLIP-seq
MIRT1149165	hsa-miR-3689a-3p	CLIP-seq
MIRT1149166	hsa-miR-3689c	CLIP-seq
MIRT1149167	hsa-miR-3913-5p	CLIP-seq
MIRT1149176	hsa-miR-4701-5p	CLIP-seq
MIRT1149179	hsa-miR-4728-5p	CLIP-seq
MIRT1149182	hsa-miR-588	CLIP-seq
MIRT1149183	hsa-miR-940	CLIP-seq
MIRT2571086	hsa-miR-1268	CLIP-seq
MIRT2571087	hsa-miR-1268b	CLIP-seq
MIRT2571088	hsa-miR-1270	CLIP-seq
MIRT1149161	hsa-miR-338-3p	CLIP-seq
MIRT2571089	hsa-miR-3545-3p	CLIP-seq
MIRT2571090	hsa-miR-3675-3p	CLIP-seq
MIRT2571091	hsa-miR-4426	CLIP-seq
MIRT2571092	hsa-miR-4486	CLIP-seq
MIRT1149172	hsa-miR-4530	CLIP-seq
MIRT2571093	hsa-miR-4534	CLIP-seq
MIRT2571094	hsa-miR-4536	CLIP-seq
MIRT2571095	hsa-miR-4646-5p	CLIP-seq
MIRT2571096	hsa-miR-4647	CLIP-seq
MIRT2571097	hsa-miR-4662b	CLIP-seq
MIRT2571098	hsa-miR-4683	CLIP-seq
MIRT2571099	hsa-miR-4684-5p	CLIP-seq
MIRT1149177	hsa-miR-4703-3p	CLIP-seq
MIRT2571100	hsa-miR-4747-5p	CLIP-seq
MIRT2571101	hsa-miR-4781-5p	CLIP-seq
MIRT2571102	hsa-miR-548c-3p	CLIP-seq
MIRT2571103	hsa-miR-580	CLIP-seq
MIRT2571104	hsa-miR-585	CLIP-seq
MIRT2571105	hsa-miR-620	CLIP-seq
MIRT2571086	hsa-miR-1268	CLIP-seq
MIRT2571087	hsa-miR-1268b	CLIP-seq
MIRT2571089	hsa-miR-3545-3p	CLIP-seq
MIRT2571090	hsa-miR-3675-3p	CLIP-seq
MIRT2571092	hsa-miR-4486	CLIP-seq
MIRT2571094	hsa-miR-4536	CLIP-seq
MIRT2571099	hsa-miR-4684-5p	CLIP-seq
MIRT2571101	hsa-miR-4781-5p	CLIP-seq
MIRT2571102	hsa-miR-548c-3p	CLIP-seq
MIRT2571103	hsa-miR-580	CLIP-seq
MIRT2571104	hsa-miR-585	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20526344
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0033004	Process	Negative regulation of mast cell activation	ISS
GO:0043303	Process	Mast cell degranulation	ISS

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q7Z6M3

Protein name

Allergin-1 (Allergy inhibitory receptor 1) (Mast cell antigen 32) (MCA-32) (Mast cell immunoglobulin-like receptor 1)

Protein function

Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17736	Ig_C17orf99	37 → 119	C17orf99 Ig domain	Domain
PF17736	Ig_C17orf99	124 → 217	C17orf99 Ig domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in myeloid cells (dendritic cells, macrophages and neutrophils, weak expression on B-cells but not in T-cells or natural killer cells), peripheral blood basophils and mast cells (at protein level). {ECO:0000269|PubMed:2052634

Sequence

MWSHLNRLLFWSIFSSVTCRKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKN
KSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFT
IVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAE
FNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLKLLLPGLLLLLVVI
ILILAFWVLPKYKTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVST
AQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF

Sequence length

343

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DNA DEPLETION SYNDROME 16	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DNA DEPLETION SYNDROME 16B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA, HEREDITARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30556363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33190167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30556363		★★★★★ ★☆☆☆☆ Found in Text Mining only

MILR1 (mast cell immunoglobulin like receptor 1)