GPR17 (G protein-coupled receptor 17)

Gene

• Entrez ID: 2840
• Gene name: G protein-coupled receptor 17
• Gene symbol: GPR17
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2q14.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018345	hsa-miR-335-5p	Microarray	18185580
MIRT029794	hsa-miR-26b-5p	Microarray	19088304
MIRT1030888	hsa-miR-1236	CLIP-seq
MIRT1030889	hsa-miR-185	CLIP-seq
MIRT1030890	hsa-miR-2682	CLIP-seq
MIRT1030891	hsa-miR-34a	CLIP-seq
MIRT1030892	hsa-miR-34c-5p	CLIP-seq
MIRT1030893	hsa-miR-4269	CLIP-seq
MIRT1030894	hsa-miR-4302	CLIP-seq
MIRT1030895	hsa-miR-4306	CLIP-seq
MIRT1030896	hsa-miR-449a	CLIP-seq
MIRT1030897	hsa-miR-449b	CLIP-seq
MIRT1030898	hsa-miR-449c	CLIP-seq
MIRT1030899	hsa-miR-4514	CLIP-seq
MIRT1030900	hsa-miR-4644	CLIP-seq
MIRT1030901	hsa-miR-4692	CLIP-seq
MIRT1030902	hsa-miR-4722-5p	CLIP-seq
MIRT1030903	hsa-miR-4742-5p	CLIP-seq
MIRT1030904	hsa-miR-4768-3p	CLIP-seq
MIRT1030905	hsa-miR-510	CLIP-seq
MIRT1030906	hsa-miR-520a-5p	CLIP-seq
MIRT1030907	hsa-miR-525-5p	CLIP-seq
MIRT1030908	hsa-miR-593	CLIP-seq
MIRT2005826	hsa-miR-193a-5p	CLIP-seq
MIRT2450622	hsa-miR-136	CLIP-seq
MIRT2450623	hsa-miR-3127-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	8558062
GO:0005515	Function	Protein binding	IPI	36613703
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8558062
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8558062
GO:0016020	Component	Membrane	IEA
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

Other IDs

• MIM: 603071
• HGNC: 4471
• e!Ensembl: ENSG00000144230

Protein

• UniProt ID: Q13304
• Protein name: Uracil nucleotide/cysteinyl leukotriene receptor (UDP/CysLT receptor) (G-protein coupled receptor 17) (P2Y-like receptor) (R12)
• Protein function: Dual specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). Signals through G(i) and inhibition of adenylyl cyclase. May mediate brain damage by nucleotides and CysLTs following ischemia.
• PDB: 7Y89
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	76 → 325	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, kidney, heart and umbilical vein endothelial cells. Highest level in brain. {ECO:0000269|PubMed:16990797}.
• Sequence:

  MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM
  LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF
  SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC
  AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY
  LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ
  RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS
  LSAKSEL

• Sequence length: 367

Pathways

Reactome:

Leukotriene receptors
G alpha (q) signalling events
P2Y receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bloom Syndrome	Bloom Syndrome	BEFREE	30036769		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	CTD_human_DG	18974869		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	23801362	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	2491011		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28594400, 30036769		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28223679, 28523591, 28594400, 30640576		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	25876005		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29161055		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29540737		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	7802042		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25876005		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27810435		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30640576		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30640576		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32897363, 37054539	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25876005		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	34144038	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34144038	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	23801362	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	2491011		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28827203, 29757570, 31171403		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30640576		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	34144038	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37054539	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28223679, 28827203, 30640576		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25876005		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29161055		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29161055	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25176350, 29725435		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28828731		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34144038	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	28827203		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30640576		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	8725781		★☆☆☆☆ Found in Text Mining only