Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	284
Gene name	Angiopoietin 1
Gene symbol	ANGPT1
Synonyms (NCBI Gene)	AGP1AGPTAGPT-1ANG1HAE5
Chromosome	8
Chromosome location	8q23.1
Summary	This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments
MIRT781397	hsa-miR-1253	CLIP-seq
MIRT781398	hsa-miR-3074-3p	CLIP-seq
MIRT781399	hsa-miR-3161	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT781401	hsa-miR-3919	CLIP-seq
MIRT781402	hsa-miR-4328	CLIP-seq
MIRT781403	hsa-miR-4705	CLIP-seq
MIRT781404	hsa-miR-526b	CLIP-seq
MIRT781397	hsa-miR-1253	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT781407	hsa-miR-181a	CLIP-seq
MIRT781408	hsa-miR-181b	CLIP-seq
MIRT781409	hsa-miR-181c	CLIP-seq
MIRT781410	hsa-miR-181d	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT781412	hsa-miR-3154	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT781415	hsa-miR-3682-3p	CLIP-seq
MIRT781416	hsa-miR-4262	CLIP-seq
MIRT781417	hsa-miR-4428	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT781419	hsa-miR-4716-5p	CLIP-seq
MIRT781420	hsa-miR-4738-3p	CLIP-seq
MIRT781421	hsa-miR-4774-5p	CLIP-seq
MIRT781422	hsa-miR-570	CLIP-seq
MIRT781423	hsa-miR-580	CLIP-seq
MIRT781424	hsa-miR-582-3p	CLIP-seq
MIRT781425	hsa-miR-603	CLIP-seq
MIRT2441939	hsa-miR-204	CLIP-seq
MIRT2441940	hsa-miR-211	CLIP-seq
MIRT2441941	hsa-miR-214	CLIP-seq
MIRT2441942	hsa-miR-3619-5p	CLIP-seq
MIRT2441943	hsa-miR-4291	CLIP-seq
MIRT2441944	hsa-miR-4659a-3p	CLIP-seq
MIRT2441945	hsa-miR-4659b-3p	CLIP-seq
MIRT2441946	hsa-miR-4755-5p	CLIP-seq
MIRT2441947	hsa-miR-623	CLIP-seq
MIRT2441948	hsa-miR-761	CLIP-seq
MIRT2441949	hsa-miR-922	CLIP-seq
MIRT2473895	hsa-miR-1243	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT2473896	hsa-miR-23a	CLIP-seq
MIRT2473897	hsa-miR-23b	CLIP-seq
MIRT2473898	hsa-miR-23c	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT2473899	hsa-miR-3143	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT2473900	hsa-miR-3164	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT2473901	hsa-miR-337-5p	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT2473902	hsa-miR-3611	CLIP-seq
MIRT2473903	hsa-miR-3654	CLIP-seq
MIRT2473904	hsa-miR-371-5p	CLIP-seq
MIRT2473905	hsa-miR-4257	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT2473906	hsa-miR-4680-5p	CLIP-seq
MIRT2473907	hsa-miR-4695-5p	CLIP-seq
MIRT2473908	hsa-miR-4712-3p	CLIP-seq
MIRT2473909	hsa-miR-4753-3p	CLIP-seq
MIRT2473910	hsa-miR-4766-5p	CLIP-seq
MIRT2473911	hsa-miR-4789-3p	CLIP-seq
MIRT2473912	hsa-miR-4799-5p	CLIP-seq
MIRT2473913	hsa-miR-513a-3p	CLIP-seq
MIRT2473914	hsa-miR-543	CLIP-seq
MIRT2473915	hsa-miR-548b-3p	CLIP-seq
MIRT2473916	hsa-miR-548l	CLIP-seq
MIRT2473917	hsa-miR-548n	CLIP-seq
MIRT2473918	hsa-miR-548u	CLIP-seq
MIRT2473919	hsa-miR-581	CLIP-seq
MIRT2473920	hsa-miR-593	CLIP-seq
MIRT2473921	hsa-miR-606	CLIP-seq
MIRT2473922	hsa-miR-617	CLIP-seq
MIRT2473923	hsa-miR-642b	CLIP-seq
MIRT2473924	hsa-miR-885-5p	CLIP-seq
MIRT2473925	hsa-miR-888	CLIP-seq
MIRT2473895	hsa-miR-1243	CLIP-seq
MIRT2674983	hsa-miR-1257	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT2674984	hsa-miR-1305	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT2674985	hsa-miR-144	CLIP-seq
MIRT2674986	hsa-miR-19a	CLIP-seq
MIRT2674987	hsa-miR-19b	CLIP-seq
MIRT2473896	hsa-miR-23a	CLIP-seq
MIRT2473897	hsa-miR-23b	CLIP-seq
MIRT2473898	hsa-miR-23c	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT2473899	hsa-miR-3143	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT2473900	hsa-miR-3164	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT2473901	hsa-miR-337-5p	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT2473902	hsa-miR-3611	CLIP-seq
MIRT2473903	hsa-miR-3654	CLIP-seq
MIRT2473904	hsa-miR-371-5p	CLIP-seq
MIRT2674988	hsa-miR-3977	CLIP-seq
MIRT2473905	hsa-miR-4257	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT2674989	hsa-miR-4670-3p	CLIP-seq
MIRT2473906	hsa-miR-4680-5p	CLIP-seq
MIRT2473907	hsa-miR-4695-5p	CLIP-seq
MIRT2674990	hsa-miR-4698	CLIP-seq
MIRT2674991	hsa-miR-4709-5p	CLIP-seq
MIRT2473908	hsa-miR-4712-3p	CLIP-seq
MIRT2473909	hsa-miR-4753-3p	CLIP-seq
MIRT2473910	hsa-miR-4766-5p	CLIP-seq
MIRT2473911	hsa-miR-4789-3p	CLIP-seq
MIRT2473912	hsa-miR-4799-5p	CLIP-seq
MIRT2473913	hsa-miR-513a-3p	CLIP-seq
MIRT2473914	hsa-miR-543	CLIP-seq
MIRT2473915	hsa-miR-548b-3p	CLIP-seq
MIRT2473916	hsa-miR-548l	CLIP-seq
MIRT2473917	hsa-miR-548n	CLIP-seq
MIRT2473918	hsa-miR-548u	CLIP-seq
MIRT2473919	hsa-miR-581	CLIP-seq
MIRT2473920	hsa-miR-593	CLIP-seq
MIRT2473921	hsa-miR-606	CLIP-seq
MIRT2674992	hsa-miR-607	CLIP-seq
MIRT2473922	hsa-miR-617	CLIP-seq
MIRT2473923	hsa-miR-642b	CLIP-seq
MIRT2473924	hsa-miR-885-5p	CLIP-seq
MIRT2473925	hsa-miR-888	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ING4	Repression	20707719

Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	8980223
GO:0002040	Process	Sprouting angiogenesis	IDA	9560344, 10218485
GO:0002092	Process	Positive regulation of receptor internalization	IDA	19424712
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	20708158, 25814554, 29106382
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8980223, 10218485
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	19424712
GO:0005902	Component	Microvillus	IDA	19424712
GO:0007162	Process	Negative regulation of cell adhesion	IDA	19674970
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007171	Process	Activation of transmembrane receptor protein tyrosine kinase activity	IDA	19424712
GO:0007596	Process	Blood coagulation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	12958144
GO:0010628	Process	Positive regulation of gene expression	IMP	19148554
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IDA	19733541
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0030210	Process	Heparin proteoglycan biosynthetic process	IDA	19297368
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	8980223, 19922791
GO:0031012	Component	Extracellular matrix	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	19689429
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0034394	Process	Protein localization to cell surface	IDA	19615361
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042802	Function	Identical protein binding	IPI	29106382
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10218485, 12958144
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IDA	14978158, 19297368
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	9660821
GO:0045121	Component	Membrane raft	IDA	19615361
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0048014	Process	Tie signaling pathway	IBA
GO:0048014	Process	Tie signaling pathway	IDA	19689429, 19922791
GO:0048014	Process	Tie signaling pathway	NAS	19148554
GO:0048018	Function	Receptor ligand activity	IDA	29323190
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	15851516, 19689429
GO:0050820	Process	Positive regulation of coagulation	IDA	29323190
GO:0050918	Process	Positive chemotaxis	IDA	9660821
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18425120
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19615361
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18425120
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19615361
GO:0072012	Process	Glomerulus vasculature development	IEA
GO:0072012	Process	Glomerulus vasculature development	ISS
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IMP	19148554
GO:1905605	Process	Positive regulation of blood-brain barrier permeability	IMP	19148554
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	19674970
GO:2000446	Process	Regulation of macrophage migration inhibitory factor signaling pathway	IEA

MIM	HGNC	e!Ensembl
601667	484	ENSG00000154188

Q15389

Protein name

Angiopoietin-1 (ANG-1)

Protein function

Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorgan

PDB

4EPU , 4JYO , 4K0V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	282 → 496	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Sequence

MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF

Sequence length

498

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway HIF-1 signaling pathway PI3K-Akt signaling pathway Rheumatoid arthritis		Tie2 Signaling RAF/MAP kinase cascade

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Agammaglobulinemia 7, autosomal recessive	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angioedema, hereditary, 5	Uncertain significance	ClinVar ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ANGIOEDEMAS, HEREDITARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGPT1-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	Disgenet, GWAS catalog, GenCC Disgenet, GWAS catalog, GenCC Disgenet, GWAS catalog, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema type 3	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ANGIOEDEMA TYPE III	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ANGIOEDEMA WITH NORMAL C1INH NOT RELATED TO F12 OR PLG VARIANT	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CONGENITAL GLAUCOMA	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (318)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	9233584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	25120736, 28713987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	31075757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17785951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17785951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22048948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	17785951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22048948, 31385379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15501112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	30125658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24901472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39394418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30476904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	BEFREE	30476904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14600132, 31348822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	32578786, 33593719, 33799813, 36787826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	28601681, 30689269, 30827947, 31131012		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	19120365		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANGPT1-related hereditary angioedema with normal C1Inh	Hereditary Angioedema	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31658493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12628953, 21252069, 25721616, 25779847, 25957120, 26283334, 28069704, 28283184, 29066981, 29352340, 29541937, 30850299, 30865052, 31678621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12525377, 20547659, 22730375, 29209329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	12525377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12010571, 12525377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17168735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29434591, 31675376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10506510, 11304469, 11305411, 15453096, 16354591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	16354591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23592774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21252069, 25721616, 25779847, 25957120, 26283334, 28069704, 28283184, 29066981, 29352340, 29541937, 30850299, 30865052, 31678621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26283334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29884819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	21367658		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19120365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	24126820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15517881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	27990590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18420967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15607960, 21321379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	23232696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11027428, 11309342, 20937382, 22095586, 26814432, 27063099, 27703260, 28800750, 29115538, 29959560, 31642813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23232696, 27703260, 28045923, 29959560, 31619709, 31642813, 34685578, 35617355, 37176055, 39302921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18420967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	18420967, 31967847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	15900153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15517881, 24404127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12434420, 15517881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14600132, 16830384, 36157115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	21948244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15517881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12136423, 17363603, 19339077, 26225830, 27861149, 31385379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17505508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15517881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15047239, 24947924, 31076365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	29492715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12963640, 29742506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25225013, 28283184, 29157100, 29783932, 31359146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29431106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	16565972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32180680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17637706, 24607344, 26542693, 30185785, 31581897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20378606, 23894369, 25042092, 28219791, 28275651, 29663576, 30124060, 30816157, 31581897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28476896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12243755, 28720059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12243755, 28720059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16565972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	16565972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27846250, 29783932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28960804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	18480750, 18626492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19371232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28147245, 29516284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28487234, 29610929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11245414, 11571726, 12810673, 19018775, 22048948, 27840995, 31680342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17785951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22496856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22496856, 22728324, 33573134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	28818232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	24126820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	22917924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	BEFREE	29534877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21147120, 26224885, 28054808, 28096047, 28209222, 28233239, 28279521, 28833476, 28848201, 28970203, 29140957, 29685688, 31521437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17505508, 21809376, 31582532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18373738, 21738954, 31359146, 31617500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17322632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27079876, 31617500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31359146, 31617500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12010571, 12525377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30476904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	33481042	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	39245941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24009238, 27856608, 28147245, 28299329, 29212268, 31102457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24009238, 25042092, 27856608, 28147245, 28299329, 29212268, 31102457, 31470003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26120272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35932065	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35549955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22811473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28219791, 30404071, 30905634, 31102457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	31828164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	36232122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24009238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26340930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37249455	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysautonomia	Dysautonomia	BEFREE	21367658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	22205728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	35628389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	26945868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18644593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15019822, 16723371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16723371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18644593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	31328772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15047239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29667617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12239588, 18330951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12239588, 18330951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12239588, 18330951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26883384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26992300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	17724803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18823985, 19371232, 25453980, 27445100, 27502441, 28822808, 31580514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	16628261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	31320912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	17724803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	17724803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	27836528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	31573481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	GWASCAT_DG	30054594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	BEFREE	31574535		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	Pubtator	32606567	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Open-Angle	Glaucoma	GWASCAT_DG	29891935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11304469, 14712484, 20367336, 23231075, 28744448, 30229380, 30924128, 31763674, 9811337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15453096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	9811337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11304469, 14712484, 15453096, 23231075, 25708368, 28744448, 30229380, 30924128, 31763674, 9811337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17189382, 21321379, 30229380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17189382, 34162919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	26120272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28122283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26171937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28233239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21147120, 26224885, 28096047, 28209222, 28233239, 28279521, 28833476, 28970203, 29140957, 29685688, 31521437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31795484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	28041961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	11733376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	10854238, 23558570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23801605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	26945868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	20233519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28077371, 29157100, 30326474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28077371, 29157100, 30326474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31415078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31828164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31412315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	11436038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19218192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	11436038	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	12571257, 34326408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	30950337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11436038, 12571257, 14512515, 19926873, 19948988, 21367658, 22917924, 27310975, 27636897, 27889958, 28076452, 28192475, 28791402, 29541937, 29962859 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	29685981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	11436038	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	12213726	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30867055, 32351020, 35799115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	16373885, 29079808, 29752040, 30036135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21042788, 31387171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11668472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23735163, 28054808, 28147245, 29516284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	23288163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	25228068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	28394321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	24799613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	11463715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	12963640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24607344, 28864200, 31445044, 31581897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposiform Hemangioendothelioma	Kaposiform Hemangioendothelioma	BEFREE	27990590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22639821, 23762470, 27636897, 28116710, 30715105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28192475, 29654395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	34193611	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23919981, 25605239, 26802051, 29286103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16956819, 17943167, 19016730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29731883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12717391, 12808060, 14600132, 14607656, 15094228, 15888795, 16629644, 16830384, 18924243, 26225830, 27358066, 29483825, 30701027, 31609020, 31830991, 9927494 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12717391, 16830384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19371232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17599743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15888795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17363603, 19509262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	38162654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	33881493	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17189382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11027428, 11309342, 20937382, 22095586, 26814432, 27063099, 27703260, 28800750, 29115538, 29959560, 31642813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12239588, 18330951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12136423, 17363603, 19339077, 26225830, 27861149, 31385379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29731883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24947924, 31076365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21729304, 27240355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17972146, 19018775, 20583134, 26225830, 28949385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20072135, 30776942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16185665, 16614513, 16688843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15517881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12239588, 15517881, 22963500, 28533754, 28744580, 29204818, 29731883, 30361641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12243755, 28720059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11245414, 12810673, 19018775, 22048948, 27840995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27063099, 27703260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	33687603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29774102, 30201261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27509983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28438644, 30905634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24819472, 31396301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29484978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	21905000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12649156, 12930383, 23113684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12649156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12930383	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24355943	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30134823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	24163134, 28334037		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21878936, 28159737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21878936, 26802051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11755466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30100996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15510173, 17188570, 19794062, 21840594, 23978105, 28222221, 28623351, 28656296, 29259991, 31284593, 31437601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	LHGDN	16547766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	18373738, 21738954, 23514706, 31437601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28207424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	32180680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21819747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36304979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30374682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10969034, 11027428, 11245414, 11304469, 11309342, 11571726, 11668472, 11948107, 11948116, 12239588, 12243755, 12808060, 12810673, 12831061, 15015569 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	23488800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	18799719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	18799719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	17724803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15501112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29670463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	24009238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29636553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10499626, 19339077, 23725836		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30193816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29066463, 29203627, 30404738, 30905634, 31638856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31640116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	27581034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	30246378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30185785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28531801, 28536469, 31442676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20340016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24947924, 31076365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11071270	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33713666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	19018775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21729304, 27240355, 29221165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21729304, 24341512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29138810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28717903, 29387247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29428223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	30476904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	31640116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	24157526, 29876944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	24157526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19120365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	29462546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30476904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary congenital glaucoma	Congenital glaucoma	BEFREE	29106382, 31621585		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	17972146, 19018775, 20583134, 26225830, 28949385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	29802847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30361641, 30866453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	11348459	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15743796, 29864894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	25753570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	16373885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	26590154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28960804, 31837773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20846163, 28960804, 29084974, 29652517, 31256436, 31278346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12434420, 21809376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28076452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	29329358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	17803352, 30537127, 31376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	19217887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29761600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31106420, 31266060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	31266060	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	14662021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11838839, 12010571, 12525377, 14715662, 17599743, 22730375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	31377797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22963500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10854238, 25631079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	39515460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	12810673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	20509945	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	CTD_human_DG	16005988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18310225, 21531574, 23036162, 28538018, 29132435, 30367644, 30865052, 31013257, 31239174, 31705327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	20072135	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28076452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31385379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26883384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16185665, 16614513, 16688843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16614513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16614513, 19916173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	23288163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	24799613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31075243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	31573481		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15517881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	27791295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23663694	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	31632561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15517881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	10596910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	25228068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16690881, 19622383, 22917924, 23182855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23801605, 32680471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	32582222	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	31573481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	28818232		★★★★★ ★☆☆☆☆ Found in Text Mining only

ANGPT1 (angiopoietin 1)