Gene Gene information from NCBI Gene database.
Entrez ID 283927
Gene name Nudix hydrolase 7
Gene symbol NUDT7
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16q23.1
Summary The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofacto
miRNA miRNA information provided by mirtarbase database.
118
miRTarBase ID miRNA Experiments Reference
MIRT715817 hsa-miR-590-3p HITS-CLIP 19536157
MIRT715816 hsa-miR-379-3p HITS-CLIP 19536157
MIRT715815 hsa-miR-411-3p HITS-CLIP 19536157
MIRT715813 hsa-miR-4502 HITS-CLIP 19536157
MIRT715814 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0000287 Function Magnesium ion binding ISS
GO:0003723 Function RNA binding IEA
GO:0005777 Component Peroxisome IEA
GO:0005777 Component Peroxisome ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609231 8054 ENSG00000140876
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C024
Protein name Peroxisomal coenzyme A diphosphatase NUDT7 (EC 3.6.1.-) (EC 3.6.1.77) (Nucleoside diphosphate-linked moiety X motif 7) (Nudix motif 7)
Protein function Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate (By similarity). Cleaves CoA, CoA esters and oxidized CoA with similar efficiencies (By similarity). Pr
PDB 5QGG , 5QGH , 5QGI , 5QGJ , 5QGK , 5QGL , 5QGM , 5QGN , 5QGO , 5QGP , 5QGQ , 5QGR , 5QGS , 5QGT , 5QGU , 5QGV , 5QGW , 5QGX , 5QGY , 5QGZ , 5QH0 , 5QH1 , 5QH2 , 5QH3 , 5QH4 , 5QH5 , 5QH6 , 5QH7 , 5QH8 , 5QH9 , 5QHA , 5QHB , 5QHC , 5QHE , 5QHF , 5QHG , 5QHH , 5T3P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00293 NUDIX 38 166 NUDIX domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in liver, kidney, pancreas, pituitary, small intestine, spleen, heart and placenta. Weakly expressed in brain. {ECO:0000269|PubMed:11415433}.
Sequence
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVR
SEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTL
ITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRL
GHRFINHIFEYTNP
EDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Peroxisome   Peroxisomal lipid metabolism
Peroxisomal protein import
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOPATHY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Neoplasms Colorectal neoplasm Pubtator 24146633 Associate
★☆☆☆☆
Found in Text Mining only
CRANIOOSTEOARTHROPATHY Cranioosteoarthropathy BEFREE 29378847
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis BEFREE 30143643
★☆☆☆☆
Found in Text Mining only
Liver neoplasms Liver neoplasms CTD_human_DG 25058030
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of liver Liver Cancer CTD_human_DG 25058030
★☆☆☆☆
Found in Text Mining only