Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	283871
Gene name	Phosphoglycolate phosphatase
Gene symbol	PGP
Synonyms (NCBI Gene)	AUMG3PPPGPase
Chromosome	16
Chromosome location	16p13.3

342

Show/Hide all (342)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048822	hsa-miR-93-5p	CLASH	23622248
MIRT1227962	hsa-miR-106a	CLIP-seq
MIRT1227963	hsa-miR-106b	CLIP-seq
MIRT1227964	hsa-miR-1197	CLIP-seq
MIRT1227965	hsa-miR-1233	CLIP-seq
MIRT1227966	hsa-miR-1255a	CLIP-seq
MIRT1227967	hsa-miR-1255b	CLIP-seq
MIRT1227968	hsa-miR-125a-5p	CLIP-seq
MIRT1227969	hsa-miR-125b	CLIP-seq
MIRT1227970	hsa-miR-1273e	CLIP-seq
MIRT1227971	hsa-miR-1287	CLIP-seq
MIRT1227972	hsa-miR-1305	CLIP-seq
MIRT1227973	hsa-miR-1321	CLIP-seq
MIRT1227974	hsa-miR-134	CLIP-seq
MIRT1227975	hsa-miR-140-5p	CLIP-seq
MIRT1227976	hsa-miR-15a	CLIP-seq
MIRT1227977	hsa-miR-15b	CLIP-seq
MIRT1227978	hsa-miR-16	CLIP-seq
MIRT1227979	hsa-miR-17	CLIP-seq
MIRT1227980	hsa-miR-1910	CLIP-seq
MIRT1227981	hsa-miR-1913	CLIP-seq
MIRT1227982	hsa-miR-1915	CLIP-seq
MIRT1227983	hsa-miR-195	CLIP-seq
MIRT1227984	hsa-miR-20a	CLIP-seq
MIRT1227985	hsa-miR-20b	CLIP-seq
MIRT1227986	hsa-miR-2114	CLIP-seq
MIRT1227987	hsa-miR-22	CLIP-seq
MIRT1227988	hsa-miR-2467-3p	CLIP-seq
MIRT1227989	hsa-miR-2467-5p	CLIP-seq
MIRT1227990	hsa-miR-30a	CLIP-seq
MIRT1227991	hsa-miR-30b	CLIP-seq
MIRT1227992	hsa-miR-30c	CLIP-seq
MIRT1227993	hsa-miR-30d	CLIP-seq
MIRT1227994	hsa-miR-30e	CLIP-seq
MIRT1227995	hsa-miR-31	CLIP-seq
MIRT1227996	hsa-miR-3118	CLIP-seq
MIRT1227997	hsa-miR-3121-5p	CLIP-seq
MIRT1227998	hsa-miR-3136-5p	CLIP-seq
MIRT1227999	hsa-miR-3140-5p	CLIP-seq
MIRT1228000	hsa-miR-3145-5p	CLIP-seq
MIRT1228001	hsa-miR-3151	CLIP-seq
MIRT1228002	hsa-miR-3157-5p	CLIP-seq
MIRT1228003	hsa-miR-3162-3p	CLIP-seq
MIRT1228004	hsa-miR-3163	CLIP-seq
MIRT1228005	hsa-miR-3164	CLIP-seq
MIRT1228006	hsa-miR-3177-3p	CLIP-seq
MIRT1228007	hsa-miR-3184	CLIP-seq
MIRT1228008	hsa-miR-3187-3p	CLIP-seq
MIRT1228009	hsa-miR-3188	CLIP-seq
MIRT1228010	hsa-miR-3189-3p	CLIP-seq
MIRT1228011	hsa-miR-3192	CLIP-seq
MIRT1228012	hsa-miR-324-3p	CLIP-seq
MIRT1228013	hsa-miR-329	CLIP-seq
MIRT1228014	hsa-miR-3607-3p	CLIP-seq
MIRT1228015	hsa-miR-3616-3p	CLIP-seq
MIRT1228016	hsa-miR-362-3p	CLIP-seq
MIRT1228017	hsa-miR-3652	CLIP-seq
MIRT1228018	hsa-miR-3660	CLIP-seq
MIRT1228019	hsa-miR-3678-3p	CLIP-seq
MIRT1228020	hsa-miR-3686	CLIP-seq
MIRT1228021	hsa-miR-3689a-3p	CLIP-seq
MIRT1228022	hsa-miR-3689c	CLIP-seq
MIRT1228023	hsa-miR-3689d	CLIP-seq
MIRT1228024	hsa-miR-3926	CLIP-seq
MIRT1228025	hsa-miR-3973	CLIP-seq
MIRT1228026	hsa-miR-3975	CLIP-seq
MIRT1228027	hsa-miR-3977	CLIP-seq
MIRT1228028	hsa-miR-423-5p	CLIP-seq
MIRT1228029	hsa-miR-424	CLIP-seq
MIRT1228030	hsa-miR-4264	CLIP-seq
MIRT1228031	hsa-miR-4275	CLIP-seq
MIRT1228032	hsa-miR-4297	CLIP-seq
MIRT1228033	hsa-miR-4308	CLIP-seq
MIRT1228034	hsa-miR-4313	CLIP-seq
MIRT1228035	hsa-miR-4318	CLIP-seq
MIRT1228036	hsa-miR-4319	CLIP-seq
MIRT1228037	hsa-miR-4420	CLIP-seq
MIRT1228038	hsa-miR-4430	CLIP-seq
MIRT1228039	hsa-miR-4435	CLIP-seq
MIRT1228040	hsa-miR-4436a	CLIP-seq
MIRT1228041	hsa-miR-4436b-3p	CLIP-seq
MIRT1228042	hsa-miR-4439	CLIP-seq
MIRT1228043	hsa-miR-4447	CLIP-seq
MIRT1228044	hsa-miR-4472	CLIP-seq
MIRT1228045	hsa-miR-4475	CLIP-seq
MIRT1228046	hsa-miR-4492	CLIP-seq
MIRT1228047	hsa-miR-4498	CLIP-seq
MIRT1228048	hsa-miR-4513	CLIP-seq
MIRT1228049	hsa-miR-4524	CLIP-seq
MIRT1228050	hsa-miR-4526	CLIP-seq
MIRT1228051	hsa-miR-4537	CLIP-seq
MIRT1228052	hsa-miR-455-3p	CLIP-seq
MIRT1228053	hsa-miR-4640-5p	CLIP-seq
MIRT1228054	hsa-miR-4643	CLIP-seq
MIRT1228055	hsa-miR-4649-3p	CLIP-seq
MIRT1228056	hsa-miR-4650-5p	CLIP-seq
MIRT1228057	hsa-miR-4652-5p	CLIP-seq
MIRT1228058	hsa-miR-4693-3p	CLIP-seq
MIRT1228059	hsa-miR-4700-3p	CLIP-seq
MIRT1228060	hsa-miR-4701-5p	CLIP-seq
MIRT1228061	hsa-miR-4710	CLIP-seq
MIRT1228062	hsa-miR-4720-3p	CLIP-seq
MIRT1228063	hsa-miR-4721	CLIP-seq
MIRT1228064	hsa-miR-4722-3p	CLIP-seq
MIRT1228065	hsa-miR-4726-3p	CLIP-seq
MIRT1228066	hsa-miR-4726-5p	CLIP-seq
MIRT1228067	hsa-miR-4728-5p	CLIP-seq
MIRT1228068	hsa-miR-4732-3p	CLIP-seq
MIRT1228069	hsa-miR-4733-5p	CLIP-seq
MIRT1228070	hsa-miR-4739	CLIP-seq
MIRT1228071	hsa-miR-4749-3p	CLIP-seq
MIRT1228072	hsa-miR-4755-3p	CLIP-seq
MIRT1228073	hsa-miR-4756-5p	CLIP-seq
MIRT1228074	hsa-miR-4763-5p	CLIP-seq
MIRT1228075	hsa-miR-4764-3p	CLIP-seq
MIRT1228076	hsa-miR-4792	CLIP-seq
MIRT1228077	hsa-miR-4804-3p	CLIP-seq
MIRT1228078	hsa-miR-485-5p	CLIP-seq
MIRT1228079	hsa-miR-491-5p	CLIP-seq
MIRT1228080	hsa-miR-497	CLIP-seq
MIRT1228081	hsa-miR-498	CLIP-seq
MIRT1228082	hsa-miR-502-5p	CLIP-seq
MIRT1228083	hsa-miR-503	CLIP-seq
MIRT1228084	hsa-miR-507	CLIP-seq
MIRT1228085	hsa-miR-512-3p	CLIP-seq
MIRT1228086	hsa-miR-519a	CLIP-seq
MIRT1228087	hsa-miR-519b-3p	CLIP-seq
MIRT1228088	hsa-miR-519c-3p	CLIP-seq
MIRT1228089	hsa-miR-519d	CLIP-seq
MIRT1228090	hsa-miR-520g	CLIP-seq
MIRT1228091	hsa-miR-520h	CLIP-seq
MIRT1228092	hsa-miR-532-5p	CLIP-seq
MIRT1228093	hsa-miR-544b	CLIP-seq
MIRT1228094	hsa-miR-548a-3p	CLIP-seq
MIRT1228095	hsa-miR-548ac	CLIP-seq
MIRT1228096	hsa-miR-548ae	CLIP-seq
MIRT1228097	hsa-miR-548aj	CLIP-seq
MIRT1228098	hsa-miR-548am	CLIP-seq
MIRT1228099	hsa-miR-548d-3p	CLIP-seq
MIRT1228100	hsa-miR-548e	CLIP-seq
MIRT1228101	hsa-miR-548f	CLIP-seq
MIRT1228102	hsa-miR-548n	CLIP-seq
MIRT1228103	hsa-miR-548s	CLIP-seq
MIRT1228104	hsa-miR-548t	CLIP-seq
MIRT1228105	hsa-miR-548x	CLIP-seq
MIRT1228106	hsa-miR-548z	CLIP-seq
MIRT1228107	hsa-miR-557	CLIP-seq
MIRT1228108	hsa-miR-582-3p	CLIP-seq
MIRT1228109	hsa-miR-588	CLIP-seq
MIRT1228110	hsa-miR-596	CLIP-seq
MIRT1228111	hsa-miR-642a	CLIP-seq
MIRT1228112	hsa-miR-646	CLIP-seq
MIRT1228113	hsa-miR-661	CLIP-seq
MIRT1228114	hsa-miR-670	CLIP-seq
MIRT1228115	hsa-miR-759	CLIP-seq
MIRT1228116	hsa-miR-762	CLIP-seq
MIRT1228117	hsa-miR-93	CLIP-seq
MIRT1228118	hsa-miR-941	CLIP-seq
MIRT1228119	hsa-miR-943	CLIP-seq
MIRT1227965	hsa-miR-1233	CLIP-seq
MIRT1227966	hsa-miR-1255a	CLIP-seq
MIRT1227967	hsa-miR-1255b	CLIP-seq
MIRT1227998	hsa-miR-3136-5p	CLIP-seq
MIRT1228018	hsa-miR-3660	CLIP-seq
MIRT1228033	hsa-miR-4308	CLIP-seq
MIRT1228042	hsa-miR-4439	CLIP-seq
MIRT1228048	hsa-miR-4513	CLIP-seq
MIRT1228050	hsa-miR-4526	CLIP-seq
MIRT2066699	hsa-miR-103a	CLIP-seq
MIRT2066700	hsa-miR-107	CLIP-seq
MIRT2066701	hsa-miR-1184	CLIP-seq
MIRT2066702	hsa-miR-1205	CLIP-seq
MIRT1227965	hsa-miR-1233	CLIP-seq
MIRT1227966	hsa-miR-1255a	CLIP-seq
MIRT1227967	hsa-miR-1255b	CLIP-seq
MIRT1227968	hsa-miR-125a-5p	CLIP-seq
MIRT1227969	hsa-miR-125b	CLIP-seq
MIRT2066703	hsa-miR-1291	CLIP-seq
MIRT2066704	hsa-miR-1587	CLIP-seq
MIRT1227976	hsa-miR-15a	CLIP-seq
MIRT1227977	hsa-miR-15b	CLIP-seq
MIRT1227978	hsa-miR-16	CLIP-seq
MIRT1227981	hsa-miR-1913	CLIP-seq
MIRT1227983	hsa-miR-195	CLIP-seq
MIRT1227987	hsa-miR-22	CLIP-seq
MIRT1227998	hsa-miR-3136-5p	CLIP-seq
MIRT2066705	hsa-miR-3173-5p	CLIP-seq
MIRT2066706	hsa-miR-3186-5p	CLIP-seq
MIRT1228011	hsa-miR-3192	CLIP-seq
MIRT2066707	hsa-miR-3194-3p	CLIP-seq
MIRT1228012	hsa-miR-324-3p	CLIP-seq
MIRT2066708	hsa-miR-328	CLIP-seq
MIRT2066709	hsa-miR-3622a-3p	CLIP-seq
MIRT2066710	hsa-miR-3622b-3p	CLIP-seq
MIRT1228018	hsa-miR-3660	CLIP-seq
MIRT2066711	hsa-miR-3670	CLIP-seq
MIRT2066712	hsa-miR-3672	CLIP-seq
MIRT2066713	hsa-miR-370	CLIP-seq
MIRT2066714	hsa-miR-378g	CLIP-seq
MIRT2066715	hsa-miR-3921	CLIP-seq
MIRT2066716	hsa-miR-3940-3p	CLIP-seq
MIRT1228025	hsa-miR-3973	CLIP-seq
MIRT1228029	hsa-miR-424	CLIP-seq
MIRT2066717	hsa-miR-4276	CLIP-seq
MIRT2066718	hsa-miR-4303	CLIP-seq
MIRT1228033	hsa-miR-4308	CLIP-seq
MIRT1228036	hsa-miR-4319	CLIP-seq
MIRT2066719	hsa-miR-4418	CLIP-seq
MIRT1228042	hsa-miR-4439	CLIP-seq
MIRT1228046	hsa-miR-4492	CLIP-seq
MIRT2066720	hsa-miR-4493	CLIP-seq
MIRT1228047	hsa-miR-4498	CLIP-seq
MIRT1228048	hsa-miR-4513	CLIP-seq
MIRT1228049	hsa-miR-4524	CLIP-seq
MIRT1228050	hsa-miR-4526	CLIP-seq
MIRT2066721	hsa-miR-4642	CLIP-seq
MIRT2066722	hsa-miR-4653-5p	CLIP-seq
MIRT2066723	hsa-miR-4656	CLIP-seq
MIRT2066724	hsa-miR-4663	CLIP-seq
MIRT2066725	hsa-miR-4675	CLIP-seq
MIRT2066726	hsa-miR-4741	CLIP-seq
MIRT2066727	hsa-miR-4793-3p	CLIP-seq
MIRT1228080	hsa-miR-497	CLIP-seq
MIRT1228083	hsa-miR-503	CLIP-seq
MIRT2066728	hsa-miR-509-3-5p	CLIP-seq
MIRT2066729	hsa-miR-509-5p	CLIP-seq
MIRT1228090	hsa-miR-520g	CLIP-seq
MIRT1228091	hsa-miR-520h	CLIP-seq
MIRT1228095	hsa-miR-548ac	CLIP-seq
MIRT1228096	hsa-miR-548ae	CLIP-seq
MIRT1228097	hsa-miR-548aj	CLIP-seq
MIRT1228098	hsa-miR-548am	CLIP-seq
MIRT1228099	hsa-miR-548d-3p	CLIP-seq
MIRT1228105	hsa-miR-548x	CLIP-seq
MIRT1228106	hsa-miR-548z	CLIP-seq
MIRT1228108	hsa-miR-582-3p	CLIP-seq
MIRT2066730	hsa-miR-604	CLIP-seq
MIRT2066731	hsa-miR-618	CLIP-seq
MIRT2066732	hsa-miR-627	CLIP-seq
MIRT2066733	hsa-miR-642b	CLIP-seq
MIRT1228112	hsa-miR-646	CLIP-seq
MIRT1228116	hsa-miR-762	CLIP-seq
MIRT2066734	hsa-miR-924	CLIP-seq
MIRT1228118	hsa-miR-941	CLIP-seq
MIRT2066701	hsa-miR-1184	CLIP-seq
MIRT1227964	hsa-miR-1197	CLIP-seq
MIRT2066702	hsa-miR-1205	CLIP-seq
MIRT1227965	hsa-miR-1233	CLIP-seq
MIRT1227966	hsa-miR-1255a	CLIP-seq
MIRT1227967	hsa-miR-1255b	CLIP-seq
MIRT1227998	hsa-miR-3136-5p	CLIP-seq
MIRT2294346	hsa-miR-3152-5p	CLIP-seq
MIRT1228008	hsa-miR-3187-3p	CLIP-seq
MIRT1228011	hsa-miR-3192	CLIP-seq
MIRT2066707	hsa-miR-3194-3p	CLIP-seq
MIRT2294347	hsa-miR-3545-3p	CLIP-seq
MIRT1228018	hsa-miR-3660	CLIP-seq
MIRT2294348	hsa-miR-3663-5p	CLIP-seq
MIRT1228021	hsa-miR-3689a-3p	CLIP-seq
MIRT1228022	hsa-miR-3689c	CLIP-seq
MIRT1228023	hsa-miR-3689d	CLIP-seq
MIRT2294349	hsa-miR-374c	CLIP-seq
MIRT2294350	hsa-miR-3913-3p	CLIP-seq
MIRT2066715	hsa-miR-3921	CLIP-seq
MIRT2294351	hsa-miR-4252	CLIP-seq
MIRT2066717	hsa-miR-4276	CLIP-seq
MIRT2066718	hsa-miR-4303	CLIP-seq
MIRT1228033	hsa-miR-4308	CLIP-seq
MIRT2294352	hsa-miR-4425	CLIP-seq
MIRT1228039	hsa-miR-4435	CLIP-seq
MIRT1228042	hsa-miR-4439	CLIP-seq
MIRT2066720	hsa-miR-4493	CLIP-seq
MIRT2294353	hsa-miR-4504	CLIP-seq
MIRT2294354	hsa-miR-450b-3p	CLIP-seq
MIRT1228048	hsa-miR-4513	CLIP-seq
MIRT1228050	hsa-miR-4526	CLIP-seq
MIRT2294355	hsa-miR-4635	CLIP-seq
MIRT1228056	hsa-miR-4650-5p	CLIP-seq
MIRT2066722	hsa-miR-4653-5p	CLIP-seq
MIRT2294356	hsa-miR-4680-5p	CLIP-seq
MIRT1228060	hsa-miR-4701-5p	CLIP-seq
MIRT1228067	hsa-miR-4728-5p	CLIP-seq
MIRT1228069	hsa-miR-4733-5p	CLIP-seq
MIRT1228072	hsa-miR-4755-3p	CLIP-seq
MIRT2294357	hsa-miR-4774-3p	CLIP-seq
MIRT2294358	hsa-miR-489	CLIP-seq
MIRT2294359	hsa-miR-542-3p	CLIP-seq
MIRT1228103	hsa-miR-548s	CLIP-seq
MIRT1228109	hsa-miR-588	CLIP-seq
MIRT2066730	hsa-miR-604	CLIP-seq
MIRT2294360	hsa-miR-655	CLIP-seq
MIRT1228113	hsa-miR-661	CLIP-seq
MIRT2294361	hsa-miR-758	CLIP-seq
MIRT2294362	hsa-miR-769-3p	CLIP-seq
MIRT1227965	hsa-miR-1233	CLIP-seq
MIRT1227966	hsa-miR-1255a	CLIP-seq
MIRT1227967	hsa-miR-1255b	CLIP-seq
MIRT1227998	hsa-miR-3136-5p	CLIP-seq
MIRT2392448	hsa-miR-3620	CLIP-seq
MIRT1228018	hsa-miR-3660	CLIP-seq
MIRT1228033	hsa-miR-4308	CLIP-seq
MIRT1228042	hsa-miR-4439	CLIP-seq
MIRT1228048	hsa-miR-4513	CLIP-seq
MIRT1228050	hsa-miR-4526	CLIP-seq
MIRT2456303	hsa-miR-1281	CLIP-seq
MIRT1228011	hsa-miR-3192	CLIP-seq
MIRT2456304	hsa-miR-4300	CLIP-seq
MIRT2456305	hsa-miR-4691-5p	CLIP-seq
MIRT2456306	hsa-miR-920	CLIP-seq
MIRT1227972	hsa-miR-1305	CLIP-seq
MIRT1227970	hsa-miR-1273e	CLIP-seq
MIRT1227972	hsa-miR-1305	CLIP-seq
MIRT1227976	hsa-miR-15a	CLIP-seq
MIRT1227977	hsa-miR-15b	CLIP-seq
MIRT1227978	hsa-miR-16	CLIP-seq
MIRT1227983	hsa-miR-195	CLIP-seq
MIRT1228008	hsa-miR-3187-3p	CLIP-seq
MIRT1228010	hsa-miR-3189-3p	CLIP-seq
MIRT1228024	hsa-miR-3926	CLIP-seq
MIRT1228029	hsa-miR-424	CLIP-seq
MIRT1228039	hsa-miR-4435	CLIP-seq
MIRT1228049	hsa-miR-4524	CLIP-seq
MIRT1228051	hsa-miR-4537	CLIP-seq
MIRT1228054	hsa-miR-4643	CLIP-seq
MIRT1228060	hsa-miR-4701-5p	CLIP-seq
MIRT1228080	hsa-miR-497	CLIP-seq
MIRT1228082	hsa-miR-502-5p	CLIP-seq
MIRT1228083	hsa-miR-503	CLIP-seq
MIRT1228094	hsa-miR-548a-3p	CLIP-seq
MIRT1228095	hsa-miR-548ac	CLIP-seq
MIRT1228096	hsa-miR-548ae	CLIP-seq
MIRT1228097	hsa-miR-548aj	CLIP-seq
MIRT1228098	hsa-miR-548am	CLIP-seq
MIRT1228099	hsa-miR-548d-3p	CLIP-seq
MIRT1228100	hsa-miR-548e	CLIP-seq
MIRT1228101	hsa-miR-548f	CLIP-seq
MIRT1228103	hsa-miR-548s	CLIP-seq
MIRT1228105	hsa-miR-548x	CLIP-seq
MIRT1228106	hsa-miR-548z	CLIP-seq
MIRT1228108	hsa-miR-582-3p	CLIP-seq
MIRT1228109	hsa-miR-588	CLIP-seq
MIRT1228112	hsa-miR-646	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000121	Function	Sn-glycerol 1-phosphatase activity	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0006114	Process	Glycerol biosynthetic process	IDA	26755581
GO:0006114	Process	Glycerol biosynthetic process	IEA
GO:0006650	Process	Glycerophospholipid metabolic process	IDA	26755581
GO:0006650	Process	Glycerophospholipid metabolic process	IEA
GO:0008967	Function	Phosphoglycolate phosphatase activity	IDA	26755581
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0043136	Function	Sn-glycerol 3-phosphatase activity	IBA
GO:0043136	Function	Sn-glycerol 3-phosphatase activity	IDA	26755581
GO:0043136	Function	Sn-glycerol 3-phosphatase activity	IEA
GO:0043262	Function	ADP phosphatase activity	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	IMP	26755581
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
172280	8909	ENSG00000184207

A6NDG6

Protein name

Glycerol-3-phosphate phosphatase (G3PP) (EC 3.1.3.21) (Aspartate-based ubiquitous Mg(2+)-dependent phosphatase) (AUM) (EC 3.1.3.48) (Phosphoglycolate phosphatase) (PGP)

Protein function

Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol. Thereby, regulates the cellular levels of glycerol-3-phosphate a metabolic intermediate of glucose, lipid and energy metabolism. Was also shown to have a 2-phosphog

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13344	Hydrolase_6	31 → 139	Haloacid dehalogenase-like hydrolase	Domain
PF13242	Hydrolase_like	232 → 315		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in all tissues including red cells, lymphocytes and cultured fibroblasts (at protein level). The highest activities occur in skeletal muscle and cardiac muscle. {ECO:0000269|PubMed:215071}.

Sequence

MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARG
KRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPK
AYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMK
LTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI
FDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSK
KKMVPDFYVDSIADLLPALQG

Sequence length

321

Interactions

View interactions

	KEGG
	Glyoxylate and dicarboxylate metabolism Metabolic pathways Carbon metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (116)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12780787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17929277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29684847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32885413, 40023574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33115695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36724603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19484671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	40023574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	7551966, 8313623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	7551966, 8313623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	1380888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	20617398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	8068207, 9209662, 9311609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16925584, 17912240, 19940361, 22521303, 22615870, 24368600, 25973019, 26279432, 26722437, 28131717, 30292104, 35449387, 40332431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36867605, 9180147	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	19079610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10562814, 22751348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25310259, 25493932, 31976328, 35426328, 36071480, 7587708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19079610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19393132, 19552816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17912240, 31952518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16800822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23608383, 27409663, 28217977, 32203206, 8098614, 9330605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11480556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15964250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23356581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27769935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22209024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	23685187	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	22209024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	23685187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	1707232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12089380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20193114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10690538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	10690538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22751348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	9885221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19288188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23637844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	34117631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10604726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	28985842, 30413921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28028715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21595915, 33326735	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16633048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28560408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	27769935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22751348, 23328208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	12089380		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12136962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18200595, 24454800, 31195716, 7587708, 8639853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10419897, 10779437, 18200595, 24615181, 32426817, 9886324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15108169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10050716, 16704962, 17200981, 20122734, 7913825, 8628017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16521213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	24676670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29678179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26182353, 9669397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18820766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40023574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	15958635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10690538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	22833464, 7632959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	7551966, 8313623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	8068207, 9209662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9865724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29765532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28937793, 8068207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38226983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23356581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28826615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	7507731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	9345062	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10500778, 9643568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30186389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32400857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10690538, 12616123, 1380888, 16521213, 18443954, 22120608, 23907948, 30662808, 8523980, 8603335, 9209662, 9865724		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28576567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10690538, 1380888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20072950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19879917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29077516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	22833464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	31176670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30430199, 35201621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10604726, 40158757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11854916, 17695494, 20684793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19879917, 28057070		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	1978860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	2821260, 3008903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	1285890, 2821260, 3008903, 3610154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	24344919	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15548804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29758594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	10690538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20072950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	17667132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22662203, 32316291, 34069490, 35328603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23799853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	22662203, 35328603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17038883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	23356581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30148172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32647186	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8980384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	22209024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	8523980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12616123, 15771954, 18296917, 22751348, 24377601, 25407491, 30551491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30904818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	15886424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40724925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22245869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	28300675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18937653		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18937653		★★★★★ ★☆☆☆☆ Found in Text Mining only

PGP (phosphoglycolate phosphatase)