Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	283742
Gene name	Family with sequence similarity 98 member B
Gene symbol	FAM98B
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q14

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020544	hsa-miR-155-5p	Proteomics	18668040
MIRT045397	hsa-miR-149-5p	CLASH	23622248
MIRT721433	hsa-miR-4728-3p	HITS-CLIP	19536157
MIRT721432	hsa-miR-4762-5p	HITS-CLIP	19536157
MIRT721431	hsa-miR-29a-5p	HITS-CLIP	19536157
MIRT721430	hsa-miR-8075	HITS-CLIP	19536157
MIRT721429	hsa-miR-3671	HITS-CLIP	19536157
MIRT721428	hsa-miR-607	HITS-CLIP	19536157
MIRT691472	hsa-miR-4453	HITS-CLIP	23313552
MIRT691471	hsa-miR-4538	HITS-CLIP	23313552
MIRT691470	hsa-miR-676-5p	HITS-CLIP	23313552
MIRT691469	hsa-miR-4666a-5p	HITS-CLIP	23313552
MIRT691468	hsa-miR-5579-3p	HITS-CLIP	23313552
MIRT691467	hsa-miR-6875-3p	HITS-CLIP	23313552
MIRT691466	hsa-miR-4659a-3p	HITS-CLIP	23313552
MIRT691465	hsa-miR-4659b-3p	HITS-CLIP	23313552
MIRT691464	hsa-miR-4659a-5p	HITS-CLIP	23313552
MIRT691463	hsa-miR-4659b-5p	HITS-CLIP	23313552
MIRT721433	hsa-miR-4728-3p	HITS-CLIP	19536157
MIRT721432	hsa-miR-4762-5p	HITS-CLIP	19536157
MIRT721431	hsa-miR-29a-5p	HITS-CLIP	19536157
MIRT721430	hsa-miR-8075	HITS-CLIP	19536157
MIRT721429	hsa-miR-3671	HITS-CLIP	19536157
MIRT721428	hsa-miR-607	HITS-CLIP	19536157
MIRT691472	hsa-miR-4453	HITS-CLIP	23313552
MIRT691471	hsa-miR-4538	HITS-CLIP	23313552
MIRT691470	hsa-miR-676-5p	HITS-CLIP	23313552
MIRT691469	hsa-miR-4666a-5p	HITS-CLIP	23313552
MIRT691468	hsa-miR-5579-3p	HITS-CLIP	23313552
MIRT691467	hsa-miR-6875-3p	HITS-CLIP	23313552
MIRT691466	hsa-miR-4659a-3p	HITS-CLIP	23313552
MIRT691465	hsa-miR-4659b-3p	HITS-CLIP	23313552
MIRT691464	hsa-miR-4659a-5p	HITS-CLIP	23313552
MIRT691463	hsa-miR-4659b-5p	HITS-CLIP	23313552
MIRT988889	hsa-miR-329	CLIP-seq
MIRT988890	hsa-miR-362-3p	CLIP-seq
MIRT988891	hsa-miR-3941	CLIP-seq
MIRT988892	hsa-miR-4731-3p	CLIP-seq
MIRT988893	hsa-miR-4789-3p	CLIP-seq
MIRT988894	hsa-miR-4801	CLIP-seq
MIRT988895	hsa-miR-4803	CLIP-seq
MIRT988896	hsa-miR-603	CLIP-seq
MIRT988897	hsa-miR-1297	CLIP-seq
MIRT988898	hsa-miR-26a	CLIP-seq
MIRT988899	hsa-miR-26b	CLIP-seq
MIRT988900	hsa-miR-3145-3p	CLIP-seq
MIRT988901	hsa-miR-3682-3p	CLIP-seq
MIRT988902	hsa-miR-3682-5p	CLIP-seq
MIRT988903	hsa-miR-4272	CLIP-seq
MIRT988904	hsa-miR-4465	CLIP-seq
MIRT988905	hsa-miR-4694-5p	CLIP-seq
MIRT988906	hsa-miR-567	CLIP-seq
MIRT988901	hsa-miR-3682-3p	CLIP-seq
MIRT988902	hsa-miR-3682-5p	CLIP-seq
MIRT2226963	hsa-miR-4263	CLIP-seq
MIRT2226964	hsa-miR-576-5p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	24608264, 28040436, 30021884
GO:0005634	Component	Nucleus	IDA	24608264
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	21311021
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18445686, 24608264
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	21311021
GO:0006388	Process	TRNA splicing, via endonucleolytic cleavage and ligation	NAS	24870230
GO:0006479	Process	Protein methylation	IMP	28040436
GO:0008276	Function	Protein methyltransferase activity	IMP	28040436
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	28040436
GO:0010628	Process	Positive regulation of gene expression	IMP	28040436
GO:0042802	Function	Identical protein binding	IDA	28040436
GO:0072669	Component	TRNA-splicing ligase complex	IBA
GO:0072669	Component	TRNA-splicing ligase complex	IDA	21311021, 24870230
GO:0072669	Component	TRNA-splicing ligase complex	NAS	24870230

MIM	HGNC	e!Ensembl
616142	26773	ENSG00000171262

Q52LJ0

Protein name

Protein FAM98B

Protein function

Positively stimulates PRMT1-induced protein arginine dimethylated arginine methylation (PubMed:28040436).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10239	DUF2465	17 → 331	Protein of unknown function (DUF2465)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (at protein level) (PubMed:28040436). Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (PubMed:28040436). {ECO:00002

Sequence

MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIK
SLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFL
STELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKD
ILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSD
RAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAINKV
LMGRVPDRGGRPNEIEPPPPEMPPWQKRQEGGGGRGGWGGGGGGGGRGGGGGGGGRGGWG
GGGGGWGGGGGGGGGWGGGGGGGRGGFQGRGDYGGRGGYGGRGGYGGRGYGDPYGGGGGG
GGGGGGGGGYRRY

Sequence length

433

Interactions

View interactions

	Reactome
			tRNA processing in the nucleus

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PSYCHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	24871463	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM98B (family with sequence similarity 98 member B)