ZDHHC22 (zDHHC palmitoyltransferase 22)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 283576
Gene name ZDHHC palmitoyltransferase 22
Gene symbol ZDHHC22
Synonyms (NCBI Gene)
C14orf59
Chromosome 14
Chromosome location 14q24.3
miRNA miRNA information provided by mirtarbase database.
602
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (602)
miRTarBase ID miRNA Experiments Reference
MIRT723556 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT723555 hsa-miR-2276-5p HITS-CLIP 19536157
MIRT723554 hsa-miR-1304-3p HITS-CLIP 19536157
MIRT723553 hsa-miR-4469 HITS-CLIP 19536157
MIRT723552 hsa-miR-7113-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 25416956, 29892012, 31515488, 32296183
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IDA 16647879
GO:0005783 Component Endoplasmic reticulum IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N966
Protein name Palmitoyltransferase ZDHHC22 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 22) (DHHC-22) (zDHHC22)
Protein function Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates and be involved in a variety of cellular processes (PubMed:22399288). Catalyzes the palmitoylation of KCNMA1, regulating localization of KCNMA1 to
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01529 DHHC 83 → 222 DHHC palmitoyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16647879}.
Sequence 
MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSAN
ALGNYVLVIQNSPDDLGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGS
RNMRNFVLFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLG
SEMFVILMLYLWFAIGLACAGFCCHQLLLILRGQTRHQVRKGVAVRARPWRKNLQEVFGK
RWLLGLLVPMFNVGSESSKQQDK
Sequence length 263
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LARGE ARTERY STROKE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 39844282 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 35541896 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only