Gene Gene information from NCBI Gene database.
Entrez ID 283377
Gene name SPRY domain containing 4
Gene symbol SPRYD4
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q13.3
miRNA miRNA information provided by mirtarbase database.
535
miRTarBase ID miRNA Experiments Reference
MIRT001588 hsa-let-7b-5p pSILAC 18668040
MIRT026083 hsa-miR-196a-5p Sequencing 20371350
MIRT028369 hsa-miR-32-5p Sequencing 20371350
MIRT032172 hsa-let-7d-5p Sequencing 20371350
MIRT001588 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 27499296, 32296183
GO:0005634 Component Nucleus IDA 17852359
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WW59
Protein name SPRY domain-containing protein 4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00622 SPRY 87 200 SPRY domain Family
Sequence
MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDMGVKYGLVGLE
PTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDR
SWVFTYAQRKWYTMLANEKAPVEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDF
RGPVVPAFALWDGELLTHSG
LEVPEGL
Sequence length 207
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 40457327 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 33950983 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 30238408
★☆☆☆☆
Found in Text Mining only