GPR6 (G protein-coupled receptor 6)

Gene

• Entrez ID: 2830
• Gene name: G protein-coupled receptor 6
• Gene symbol: GPR6
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6q21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2238552	hsa-miR-204	CLIP-seq
MIRT2238553	hsa-miR-211	CLIP-seq
MIRT2238554	hsa-miR-300	CLIP-seq
MIRT2238555	hsa-miR-3171	CLIP-seq
MIRT2238556	hsa-miR-381	CLIP-seq
MIRT2238557	hsa-miR-4666-3p	CLIP-seq
MIRT2238558	hsa-miR-496	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	7832990
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7832990
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7832990
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0016020	Component	Membrane	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IBA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA

Other IDs

• MIM: 600553
• HGNC: 4515
• e!Ensembl: ENSG00000146360

Protein

• UniProt ID: P46095
• Protein name: G-protein coupled receptor 6 (Sphingosine 1-phosphate receptor GPR6)
• Protein function: Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity).
• PDB: 8T1V, 8T1W, 8TF5, 8TYW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	89 → 329	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQL
  SAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLL
  AGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRR
  TLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGI
  MLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCV
  VGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPS
  EV

• Sequence length: 362

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32046081	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	32046081	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29345973		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32046081	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28571738		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32046081, 35110393	Associate	★☆☆☆☆ Found in Text Mining only