ANG (angiogenin)

Gene

• Entrez ID: 283
• Gene name: Angiogenin
• Gene symbol: ANG
• Synonyms (NCBI Gene): ALS9, HEL168, RAA1, RNASE4, RNASE5
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene is a member of the RNase A superfamily though it has relatively weak ribonucleolytic activity. This protein is a potent mediator of new blood vessel formation and thus, in addition to the name RNase5, is commonly called an

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006649	hsa-miR-409-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22531314
MIRT018344	hsa-miR-335-5p	Microarray	18185580
MIRT024617	hsa-miR-215-5p	Microarray	19074876
MIRT026610	hsa-miR-192-5p	Microarray	19074876
MIRT517273	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT517272	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT517271	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT707391	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT517270	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT607938	hsa-miR-6514-5p	HITS-CLIP	24906430
MIRT607937	hsa-miR-5693	HITS-CLIP	24906430
MIRT607936	hsa-miR-6812-3p	HITS-CLIP	24906430
MIRT607935	hsa-miR-4695-3p	HITS-CLIP	24906430
MIRT607934	hsa-miR-4534	HITS-CLIP	24906430
MIRT607933	hsa-miR-8082	HITS-CLIP	24906430
MIRT607932	hsa-miR-6499-3p	HITS-CLIP	24906430
MIRT607931	hsa-miR-3135b	HITS-CLIP	24906430
MIRT607930	hsa-miR-1289	HITS-CLIP	24906430
MIRT607929	hsa-miR-4294	HITS-CLIP	24906430
MIRT607928	hsa-miR-504-3p	HITS-CLIP	24906430
MIRT607927	hsa-miR-122-5p	HITS-CLIP	24906430
MIRT607926	hsa-miR-3652	HITS-CLIP	24906430
MIRT607925	hsa-miR-4430	HITS-CLIP	24906430
MIRT607924	hsa-miR-143-5p	HITS-CLIP	24906430
MIRT607923	hsa-miR-7641	HITS-CLIP	24906430
MIRT607922	hsa-miR-3198	HITS-CLIP	24906430
MIRT607921	hsa-miR-4309	HITS-CLIP	24906430
MIRT607920	hsa-miR-5698	HITS-CLIP	24906430
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT517272	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT551227	hsa-miR-378j	PAR-CLIP	21572407
MIRT551226	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT517271	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT517270	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT517272	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT517271	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT517270	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT497621	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT497620	hsa-miR-3142	PAR-CLIP	22291592
MIRT497619	hsa-miR-3922-5p	PAR-CLIP	22291592
MIRT497618	hsa-miR-454-5p	PAR-CLIP	22291592
MIRT497617	hsa-miR-3927-5p	PAR-CLIP	22291592
MIRT497616	hsa-miR-4481	PAR-CLIP	22291592
MIRT497615	hsa-miR-4745-5p	PAR-CLIP	22291592
MIRT497614	hsa-miR-18b-3p	PAR-CLIP	22291592
MIRT497613	hsa-miR-1238-5p	PAR-CLIP	22291592
MIRT497612	hsa-miR-4758-5p	PAR-CLIP	22291592
MIRT497611	hsa-miR-4658	PAR-CLIP	22291592
MIRT497610	hsa-miR-6790-5p	PAR-CLIP	22291592
MIRT497609	hsa-miR-3157-3p	PAR-CLIP	22291592
MIRT497608	hsa-miR-874-3p	PAR-CLIP	22291592
MIRT517273	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT517272	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT517271	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT707391	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT517270	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT517272	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT551227	hsa-miR-378j	PAR-CLIP	21572407
MIRT551226	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT517271	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT517270	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT517272	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT517271	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT517270	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT497621	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT497620	hsa-miR-3142	PAR-CLIP	22291592
MIRT497619	hsa-miR-3922-5p	PAR-CLIP	22291592
MIRT497618	hsa-miR-454-5p	PAR-CLIP	22291592
MIRT497617	hsa-miR-3927-5p	PAR-CLIP	22291592
MIRT497616	hsa-miR-4481	PAR-CLIP	22291592
MIRT497615	hsa-miR-4745-5p	PAR-CLIP	22291592
MIRT497614	hsa-miR-18b-3p	PAR-CLIP	22291592
MIRT497613	hsa-miR-1238-5p	PAR-CLIP	22291592
MIRT497612	hsa-miR-4758-5p	PAR-CLIP	22291592
MIRT497611	hsa-miR-4658	PAR-CLIP	22291592
MIRT497610	hsa-miR-6790-5p	PAR-CLIP	22291592
MIRT497609	hsa-miR-3157-3p	PAR-CLIP	22291592
MIRT497608	hsa-miR-874-3p	PAR-CLIP	22291592
MIRT781158	hsa-miR-3202	CLIP-seq
MIRT781159	hsa-miR-4533	CLIP-seq
MIRT781160	hsa-miR-4694-3p	CLIP-seq
MIRT781161	hsa-miR-922	CLIP-seq
MIRT781161	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CTCF	Unknown	24659782
PPARD	Repression	17511960

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IDA	8448182
GO:0001525	Process	Angiogenesis	IDA	3470787, 4074709
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IMP	2479414, 17125737
GO:0001525	Process	Angiogenesis	TAS	16567967
GO:0001541	Process	Ovarian follicle development	NAS	12770725
GO:0001556	Process	Oocyte maturation	NAS	11438326
GO:0001666	Process	Response to hypoxia	IDA	10999833, 15979542, 16490744
GO:0001666	Process	Response to hypoxia	NAS	15776477
GO:0001878	Process	Response to yeast	IDA	12548285
GO:0001890	Process	Placenta development	NAS	11984825
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	9122172, 9707554
GO:0002181	Process	Cytoplasmic translation	IDA	38718836
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IC	10649442
GO:0003677	Function	DNA binding	IEA
GO:0003779	Function	Actin binding	IDA	7679494, 11782452
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004519	Function	Endonuclease activity	TAS	10103013
GO:0004521	Function	RNA endonuclease activity	TAS
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	IDA	2424496, 2459697, 2730651, 3122207, 3289612, 3470787, 8159680, 8570639, 8622921, 11919285, 23047679
GO:0004540	Function	RNA nuclease activity	IEA
GO:0004549	Function	TRNA-specific ribonuclease activity	IDA	19332886, 20129916, 21855800, 27518564, 29100074, 29748193, 31582561, 32510170, 38718836
GO:0005102	Function	Signaling receptor binding	IDA	9122172
GO:0005507	Function	Copper ion binding	IDA	9245697
GO:0005515	Function	Protein binding	IPI	2742853, 3470787, 10413501, 15737636, 17991437, 24457100, 28514442, 28777577, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IDA	15166501
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3663649, 16461950, 16490744, 23047679, 29748193
GO:0005634	Component	Nucleus	IDA	23047679, 23843625
GO:0005634	Component	Nucleus	IDA	10649442, 15735021, 25372031
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS
GO:0005737	Component	Cytoplasm	IDA	23047679, 23843625
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006898	Process	Receptor-mediated endocytosis	IDA	29100074
GO:0007154	Process	Cell communication	NAS	10103013
GO:0007165	Process	Signal transduction	IDA	29100074
GO:0008201	Function	Heparin binding	IDA	10103013
GO:0009303	Process	RRNA transcription	IDA	27518564, 29100074, 32510170
GO:0009303	Process	RRNA transcription	IMP	15735021
GO:0009725	Process	Response to hormone	IDA	10999833
GO:0010494	Component	Cytoplasmic stress granule	IDA	27518564, 29100074
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016078	Process	TRNA decay	TAS
GO:0016477	Process	Cell migration	IMP	17125737
GO:0016787	Function	Hydrolase activity	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	12548285
GO:0019732	Process	Antifungal humoral response	IDA	12548285
GO:0019843	Function	RRNA binding	TAS	2457905
GO:0023052	Process	Signaling	IDA	2457905
GO:0030041	Process	Actin filament polymerization	ISS
GO:0030139	Component	Endocytic vesicle	IDA	29748193
GO:0030154	Process	Cell differentiation	IEA
GO:0030426	Component	Growth cone	ISS
GO:0032055	Process	Negative regulation of translation in response to stress	IDA	19332886, 20129916, 21855800, 27518564, 29100074, 31582561, 32510170, 38718836
GO:0032311	Component	Angiogenin-PRI complex	IDA	3470787
GO:0032311	Component	Angiogenin-PRI complex	IPI	3470787
GO:0033554	Process	Cellular response to stress	IDA	38718836
GO:0034063	Process	Stress granule assembly	IDA	20129916, 23047679
GO:0036416	Process	TRNA stabilization	IDA	23843625
GO:0042277	Function	Peptide binding	IDA	11782452
GO:0042327	Process	Positive regulation of phosphorylation	IDA	17125737
GO:0042592	Process	Homeostatic process	NAS	15166501
GO:0042803	Function	Protein homodimerization activity	IDA	25372031
GO:0043022	Function	Ribosome binding	IDA	38718836
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	12548285
GO:0048018	Function	Receptor ligand activity	IDA	29100074
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	10103013
GO:0050714	Process	Positive regulation of protein secretion	IDA	2646638
GO:0050714	Process	Positive regulation of protein secretion	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12548285
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12548285
GO:0071425	Process	Hematopoietic stem cell proliferation	IDA	27518564

Other IDs

• MIM: 105850
• HGNC: 483
• e!Ensembl: ENSG00000214274

Protein

• UniProt ID: P03950
• Protein name: Angiogenin (EC 3.1.27.-) (Ribonuclease 5) (RNase 5)
• Protein function: Secreted ribonuclease that can either promote or restrict cell proliferation of target cells, depending on the context (PubMed:12051708, PubMed:1400510, PubMed:19332886, PubMed:20129916, PubMed:21855800, PubMed:23047679, PubMed:23843625, PubMed:
• PDB: 1A4Y, 1ANG, 1AWZ, 1B1E, 1B1I, 1B1J, 1GV7, 1H0D, 1H52, 1H53, 1HBY, 1K58, 1K59, 1K5A, 1K5B, 1UN3, 1UN4, 1UN5, 2ANG, 4AHD, 4AHE, 4AHF, 4AHG, 4AHH, 4AHI, 4AHJ, 4AHK, 4AHL, 4AHM, 4AHN, 4AOH, 4B36, 5EOP, 5EPZ, 5EQO, 5M9A, 5M9C, 5M9G, 5M9J, 5M9M, 5M9P, 5M9Q, 5M9R, 5M9S, 5M9T, 5M9V, 7NPM, 7PNJ, 7PNP, 7PNR, 8AF0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	28 → 140	Pancreatic ribonuclease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in the liver (PubMed:2440105). Also detected in endothelial cells and spinal cord neurons (PubMed:17886298, PubMed:2440105). {ECO:0000269|PubMed:17886298, ECO:0000269|PubMed:2440105}.
• Sequence:

  MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
  SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA
  TAGFRNVVVACENGLPVHLDQSIFRRP

• Sequence length: 147

Pathways

KEGG:

Amyotrophic lateral sclerosis

Reactome:

Adherens junctions interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Amyotrophic lateral sclerosis type 9	Pathogenic; Likely pathogenic	rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544	RCV000019699 RCV000019701 RCV000019702 RCV000019703 RCV000019704 RCV000019706 RCV000019708	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Amyotrophic lateral sclerosis	Uncertain significance	ClinVar Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AMYOTROPHIC LATERAL SCLEROSIS 10	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 9	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis type 10	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANG-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal dementia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CYSTS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	16971483, 28561015, 7513352		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	7513352		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19423182, 21978170		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30657097		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21364907, 31731799		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	18094412		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33337366	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	15557516, 17900154		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	16501576, 16843725, 17462671, 17703939, 17886298, 17900154, 17916583, 18087731, 18759352, 18852347, 19363631, 19449021, 19840884, 20174961, 20942785, 21085671, 21091473, 21621297, 22072660, 22190368, 22292798, 22384259, 22752089, 23046583, 23047679, 23228179, 23231972, 23286825, 23393617, 23409128, 23665167, 25372031, 26255299, 26753798, 28120377, 28176817, 28452633, 28596290, 29279004, 29486010, 29486168, 30544007, 30710110, 31025543, 31128105, 31368019, 31431502		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	17886298, 19363631, 19449021, 20577002, 21085671, 22384259, 22752089, 23100398, 23228179, 23393617, 23665167, 23755159, 23881933, 25372031, 25386690, 26210997, 28176817, 31025543, 32111867, 33535464, 33875291, 34576228, 37208601	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	ORPHANET_DG	23941283		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	18087731		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	20577002, 23228179, 25386690	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis 9	Amyotrophic lateral sclerosis	UNIPROT_DG	15557516, 16501576, 17703939, 17886298, 17900154, 18087731, 22292843, 25372031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis 9	Amyotrophic lateral sclerosis	GENOMICS_ENGLAND_DG	25372031, 26255299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis 9	Amyotrophic lateral sclerosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis 9	Amyotrophic lateral sclerosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	18608101, 18852347, 21621297, 22292798, 23228179, 25386690, 31025543		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29190616		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12653852		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	25659096	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29507632		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24860242	Associate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15182336		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30382529		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25564356, 27317771		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29507632, 31500197		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23977052, 26272182		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23977052, 24457100	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11579593, 27317771	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14600132, 29614505, 33228611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25564356, 27317771		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	9815846		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	15581949		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29736193		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30008694		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30008694		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28918499	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25552400		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	12705339		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 2	Kidney Disease	BEFREE	31553973		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31553973		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15182336		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15182336		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	2440105, 27717848		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28561015, 9092516	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10999742, 12168899, 25374184, 29736193, 29763380, 30755821, 30828790		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12168899		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	25068345		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30042823		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19625371, 31432436		★☆☆☆☆ Found in Text Mining only
Corpus Luteum Cyst	Corpus Luteum Cyst	CTD_human_DG	21239663		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12653852		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	23229115	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30657097		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31553973		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39273664	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	8593944		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31485452		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Distal amyotrophy	Distal amyotrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	25365709		★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	21364907		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27247515	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15581949		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15236995		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18955785	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29982401		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	9815846		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	19449021	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11948474, 22531314		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	22072660		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	7513352		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	35119039	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20805979, 30408555, 31072237		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25659096	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31072237	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20805979, 29507632, 30408555, 31072237		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30620881		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	31731799		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19625371, 31432436		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31795484, 35945262	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	25068345		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22526325		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33574979	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30530896	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19363631	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23419171	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31649814		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24860242	Associate	★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	25068345		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	11463715	Associate	★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lateral Sclerosis	Lateral Sclerosis	BEFREE	18781822		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15182336, 29100074		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26472728	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11847008, 12209593		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	23155438	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12601367, 29614505, 31109401, 7513352		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	19449021, 21085671, 25404306	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11948474		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	15182336		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21439815		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21439815		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	22526325, 30378541		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	21364907	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31731799	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33115414	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30382529		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	31500197		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23977052, 26272182		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10206479, 29606349		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11705882, 11948474, 16971483, 19276260, 21352472, 23851444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	7513352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25564356, 27317771		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10206479, 12168899, 16971483, 17270024, 19276260, 21426933, 26705141, 29660986, 30529768		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27717848		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10197632, 21528671		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21426933		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	28918499	Inhibit	★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	LHGDN	17462671		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	28176817		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	28176817	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	14671622		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	7528139	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	23155438	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	11847008		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25889213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	31016577		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	23229115	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21711968		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11705882, 11948474, 12746434, 16391790, 16971483, 17869204, 21439815, 21528671, 23989187, 24561529, 24769129, 27317771, 28120377, 29507632, 30529768, 31333092, 3619929, 7528139, 9305884		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	25082408	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20174961, 21091473, 29660986, 31128105		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22384259, 24659782, 25372031, 34576228	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16501576, 17900154, 20174961, 26705141, 28127696, 29100074, 29486010, 29660986, 31128105		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	CTD_human_DG	21239663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31412919		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33713666	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	21352472		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10206479, 29606349		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	10206479		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21091473, 22190368, 23047679, 23231972, 23409128, 25386690, 28176817		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	25386690, 28176817, 32111867, 33875291, 34576228	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	25386690	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	25386690		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25124701		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31485452		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11705882, 11948474, 16971483, 19276260, 21352472, 23851444		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16971483		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11705882		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16322296		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38087324	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	23989187		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18808740		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31106420		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12653852		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	22130534, 22438557	Stimulate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	22072660		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27667357		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	7513352		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10961390, 12684892, 16937522, 33589575	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	25068345		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	39273664	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11579593, 25387487, 27317771, 34898568, 35072652	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23229115, 28918499	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28918499		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	25082408	Associate	★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	25068345		★☆☆☆☆ Found in Text Mining only