Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	282679
Gene name	Aquaporin 11
Gene symbol	AQP11
Synonyms (NCBI Gene)	AQPX1
Chromosome	11
Chromosome location	11q14.1

103

Show/Hide all (103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019715	hsa-miR-375	Microarray	20215506
MIRT791365	hsa-miR-103a	CLIP-seq
MIRT791366	hsa-miR-107	CLIP-seq
MIRT791367	hsa-miR-1253	CLIP-seq
MIRT791368	hsa-miR-128	CLIP-seq
MIRT791369	hsa-miR-1303	CLIP-seq
MIRT791370	hsa-miR-15a	CLIP-seq
MIRT791371	hsa-miR-15b	CLIP-seq
MIRT791372	hsa-miR-16	CLIP-seq
MIRT791373	hsa-miR-195	CLIP-seq
MIRT791374	hsa-miR-204	CLIP-seq
MIRT791375	hsa-miR-211	CLIP-seq
MIRT791376	hsa-miR-219-5p	CLIP-seq
MIRT791377	hsa-miR-2467-5p	CLIP-seq
MIRT791378	hsa-miR-27a	CLIP-seq
MIRT791379	hsa-miR-27b	CLIP-seq
MIRT791380	hsa-miR-3119	CLIP-seq
MIRT791381	hsa-miR-3123	CLIP-seq
MIRT791382	hsa-miR-3135b	CLIP-seq
MIRT791383	hsa-miR-3163	CLIP-seq
MIRT791384	hsa-miR-3174	CLIP-seq
MIRT791385	hsa-miR-3188	CLIP-seq
MIRT791386	hsa-miR-3614-5p	CLIP-seq
MIRT791387	hsa-miR-3652	CLIP-seq
MIRT791388	hsa-miR-3662	CLIP-seq
MIRT791389	hsa-miR-374c	CLIP-seq
MIRT791390	hsa-miR-380	CLIP-seq
MIRT791391	hsa-miR-3925-5p	CLIP-seq
MIRT791392	hsa-miR-3975	CLIP-seq
MIRT791393	hsa-miR-424	CLIP-seq
MIRT791394	hsa-miR-4251	CLIP-seq
MIRT791395	hsa-miR-4267	CLIP-seq
MIRT791396	hsa-miR-4310	CLIP-seq
MIRT791397	hsa-miR-4430	CLIP-seq
MIRT791398	hsa-miR-4505	CLIP-seq
MIRT791399	hsa-miR-4524	CLIP-seq
MIRT791400	hsa-miR-4633-3p	CLIP-seq
MIRT791401	hsa-miR-4636	CLIP-seq
MIRT791402	hsa-miR-4668-3p	CLIP-seq
MIRT791403	hsa-miR-4755-5p	CLIP-seq
MIRT791404	hsa-miR-4760-5p	CLIP-seq
MIRT791405	hsa-miR-4775	CLIP-seq
MIRT791406	hsa-miR-4777-3p	CLIP-seq
MIRT791407	hsa-miR-4782-3p	CLIP-seq
MIRT791408	hsa-miR-4793-5p	CLIP-seq
MIRT791409	hsa-miR-4796-5p	CLIP-seq
MIRT791410	hsa-miR-485-5p	CLIP-seq
MIRT791411	hsa-miR-486-5p	CLIP-seq
MIRT791412	hsa-miR-497	CLIP-seq
MIRT791413	hsa-miR-499-3p	CLIP-seq
MIRT791414	hsa-miR-499a-3p	CLIP-seq
MIRT791415	hsa-miR-503	CLIP-seq
MIRT791416	hsa-miR-5096	CLIP-seq
MIRT791417	hsa-miR-513a-5p	CLIP-seq
MIRT791418	hsa-miR-590-3p	CLIP-seq
MIRT791419	hsa-miR-623	CLIP-seq
MIRT791420	hsa-miR-646	CLIP-seq
MIRT791421	hsa-miR-647	CLIP-seq
MIRT791422	hsa-miR-655	CLIP-seq
MIRT791423	hsa-miR-875-5p	CLIP-seq
MIRT791424	hsa-miR-921	CLIP-seq
MIRT1933439	hsa-miR-1207-3p	CLIP-seq
MIRT1933440	hsa-miR-1269	CLIP-seq
MIRT1933441	hsa-miR-1269b	CLIP-seq
MIRT1933442	hsa-miR-1288	CLIP-seq
MIRT791374	hsa-miR-204	CLIP-seq
MIRT791375	hsa-miR-211	CLIP-seq
MIRT1933443	hsa-miR-297	CLIP-seq
MIRT1933444	hsa-miR-3117-5p	CLIP-seq
MIRT1933445	hsa-miR-3149	CLIP-seq
MIRT1933446	hsa-miR-3682-5p	CLIP-seq
MIRT791389	hsa-miR-374c	CLIP-seq
MIRT1933447	hsa-miR-378	CLIP-seq
MIRT1933448	hsa-miR-378b	CLIP-seq
MIRT1933449	hsa-miR-378c	CLIP-seq
MIRT1933450	hsa-miR-378d	CLIP-seq
MIRT1933451	hsa-miR-378e	CLIP-seq
MIRT1933452	hsa-miR-378f	CLIP-seq
MIRT1933453	hsa-miR-378h	CLIP-seq
MIRT1933454	hsa-miR-378i	CLIP-seq
MIRT1933455	hsa-miR-422a	CLIP-seq
MIRT791395	hsa-miR-4267	CLIP-seq
MIRT1933456	hsa-miR-4515	CLIP-seq
MIRT1933457	hsa-miR-4740-5p	CLIP-seq
MIRT791403	hsa-miR-4755-5p	CLIP-seq
MIRT791408	hsa-miR-4793-5p	CLIP-seq
MIRT791411	hsa-miR-486-5p	CLIP-seq
MIRT791413	hsa-miR-499-3p	CLIP-seq
MIRT791414	hsa-miR-499a-3p	CLIP-seq
MIRT1933458	hsa-miR-567	CLIP-seq
MIRT1933459	hsa-miR-605	CLIP-seq
MIRT791419	hsa-miR-623	CLIP-seq
MIRT791422	hsa-miR-655	CLIP-seq
MIRT1933460	hsa-miR-888	CLIP-seq
MIRT791368	hsa-miR-128	CLIP-seq
MIRT791378	hsa-miR-27a	CLIP-seq
MIRT791379	hsa-miR-27b	CLIP-seq
MIRT791405	hsa-miR-4775	CLIP-seq
MIRT791406	hsa-miR-4777-3p	CLIP-seq
MIRT791416	hsa-miR-5096	CLIP-seq
MIRT791417	hsa-miR-513a-5p	CLIP-seq
MIRT791418	hsa-miR-590-3p	CLIP-seq
MIRT791423	hsa-miR-875-5p	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	24918044, 31546170
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	31546170
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	ISS
GO:0006612	Process	Protein targeting to membrane	IEA
GO:0006612	Process	Protein targeting to membrane	ISS
GO:0006811	Process	Monoatomic ion transport	IDA	16650285
GO:0006833	Process	Water transport	IDA	16650285
GO:0006833	Process	Water transport	IMP	24845055
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	30563120
GO:0009986	Component	Cell surface	IDA	16650285
GO:0009992	Process	Intracellular water homeostasis	IDA	24918044
GO:0009992	Process	Intracellular water homeostasis	IEA
GO:0009992	Process	Intracellular water homeostasis	IMP	24845055
GO:0009992	Process	Intracellular water homeostasis	ISS
GO:0015250	Function	Water channel activity	IDA	24918044
GO:0015250	Function	Water channel activity	IMP	24845055
GO:0015250	Function	Water channel activity	ISS
GO:0015254	Function	Glycerol channel activity	IMP	24845055
GO:0015267	Function	Channel activity	IBA
GO:0015267	Function	Channel activity	IEA
GO:0015793	Process	Glycerol transmembrane transport	IDA	16650285
GO:0015793	Process	Glycerol transmembrane transport	IMP	24845055
GO:0015840	Process	Urea transport	IDA	16650285
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032364	Process	Intracellular oxygen homeostasis	IEA
GO:0048388	Process	Endosomal lumen acidification	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0051260	Process	Protein homooligomerization	IDA	24918044
GO:0051260	Process	Protein homooligomerization	IEA
GO:0051260	Process	Protein homooligomerization	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0072014	Process	Proximal tubule development	IEA
GO:0072014	Process	Proximal tubule development	ISS
GO:0080170	Process	Hydrogen peroxide transmembrane transport	IMP	31546170
GO:0140070	Function	Hydrogen peroxide channel activity	IDA	31546170
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	ISS
GO:1904293	Process	Negative regulation of ERAD pathway	IEA
GO:1904293	Process	Negative regulation of ERAD pathway	ISS

MIM	HGNC	e!Ensembl
609914	19940	ENSG00000178301

Q8NBQ7

Protein name

Aquaporin-11 (AQP-11)

Protein function

Channel protein that facilitates the transport of water, glycerol and hydrogen peroxide across membrane of cell or organelles guaranteeing intracellular homeostasis in several organes like liver, kidney and brain (PubMed:24845055, PubMed:2491804

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00230	MIP	69 → 254	Major intrinsic protein	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in the sperm head and tail (at protein level) (PubMed:28042826). Expressed in subcutaneous adipocytes (PubMed:24845055). Expressed in testis, kidney and ejaculated spermatozoa (PubMed:19812234). {ECO:0000269|PubMed:19812234, E

Sequence

MSPLLGLRSELQDTCTSLGLMLSVVLLMGLARVVARQQLHRPVAHAFVLEFLATFQLCCC
THELQLLSEQHPAHPTWTLTLVYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMSPETGAVR
LLAQLVSALCSRYCTSALWSLGLTQYHVSERSFACKNPIRVDLLKAVITEAVCSFLFHSA
LLHFQEVRTKLRIHLLAALITFLVYAGGSLTGAVFNPALALSLHFMCFDEAFPQFFIVYW
LAPSLGILLMILMFSFFLPWLHNNHTINKKE

Sequence length

271

Interactions

View interactions

	Reactome
			Passive transport by Aquaporins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36254092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30010847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26719361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26719361, 32512939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30010847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26719361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30010847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	35528520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26719361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26719361, 30010847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26719361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35528520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32512939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29472315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	26798062		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	26798062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	29678898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29678898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AQP11 (aquaporin 11)