SLCO1B3 (solute carrier organic anion transporter family member 1B3)

Gene

• Entrez ID: 28234
• Gene name: Solute carrier organic anion transporter family member 1B3
• Gene symbol: SLCO1B3
• Synonyms (NCBI Gene): HBLRR, LST-2, LST-3TM13, LST3, OATP-8, OATP1B3, OATP8, SLC21A8
• Chromosome: 12
• Chromosome location: 12p12.2
• Summary: This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of endogenous and xenobiotic compounds and plays a critical role in bile acid an

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT614563	hsa-miR-8485	HITS-CLIP	21572407
MIRT614562	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT614561	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT614560	hsa-miR-603	HITS-CLIP	21572407
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT707567	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT707566	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT614557	hsa-miR-3941	HITS-CLIP	21572407
MIRT707565	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707564	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT531991	hsa-miR-3936	PAR-CLIP	22012620
MIRT531990	hsa-miR-4457	PAR-CLIP	22012620
MIRT531989	hsa-miR-4639-3p	PAR-CLIP	22012620
MIRT531988	hsa-miR-1470	PAR-CLIP	22012620
MIRT531987	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT531986	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT531985	hsa-miR-4469	PAR-CLIP	22012620
MIRT531984	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT531983	hsa-miR-4287	PAR-CLIP	22012620
MIRT531982	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT531981	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT531980	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT732660	hsa-miR-579-3p	Luciferase reporter assay, qRT-PCR	34031488
MIRT614563	hsa-miR-8485	HITS-CLIP	21572407
MIRT614562	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT614561	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT614560	hsa-miR-603	HITS-CLIP	21572407
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT707567	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT707566	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT614557	hsa-miR-3941	HITS-CLIP	21572407
MIRT707565	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707564	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT531991	hsa-miR-3936	PAR-CLIP	22012620
MIRT531990	hsa-miR-4457	PAR-CLIP	22012620
MIRT531989	hsa-miR-4639-3p	PAR-CLIP	22012620
MIRT531988	hsa-miR-1470	PAR-CLIP	22012620
MIRT531987	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT531986	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT531985	hsa-miR-4469	PAR-CLIP	22012620
MIRT531984	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT531983	hsa-miR-4287	PAR-CLIP	22012620
MIRT531982	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT531981	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT531980	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT1369311	hsa-miR-3910	CLIP-seq
MIRT1369312	hsa-miR-4484	CLIP-seq
MIRT1369313	hsa-miR-520g	CLIP-seq
MIRT1369314	hsa-miR-520h	CLIP-seq
MIRT1369315	hsa-miR-548an	CLIP-seq
MIRT1369316	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXA2	Unknown	16741617
HNF1A	Unknown	16741617
NR1H4	Unknown	16741617

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10779507
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	19129463, 26383540
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS	10779507
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015125	Function	Bile acid transmembrane transporter activity	TAS
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS
GO:0015711	Process	Organic anion transport	TAS	10779507
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015721	Process	Bile acid and bile salt transport	TAS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0042167	Process	Heme catabolic process	TAS
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0043252	Process	Sodium-independent organic anion transport	TAS
GO:0055085	Process	Transmembrane transport	IEA

Other IDs

• MIM: 605495
• HGNC: 10961
• e!Ensembl: ENSG00000111700

Protein

• UniProt ID: Q9NPD5
• Protein name: Solute carrier organic anion transporter family member 1B3 (Liver-specific organic anion transporter 2) (LST-2) (OATP1B3) (Organic anion transporter 8) (Organic anion-transporting polypeptide 8) (OATP-8) (Solute carrier family 21 member 8)
• Protein function: Mediates the Na(+)-independent uptake of organic anions (PubMed:10779507, PubMed:15159445, PubMed:17412826). Shows broad substrate specificity, can transport both organic anions such as bile acid taurocholate (cholyltaurine) and conjugated stero
• PDB: 8PG0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03137	OATP	29 → 621	Organic Anion Transporter Polypeptide (OATP) family	Family
  PF07648	Kazal_2	460 → 506	Kazal-type serine protease inhibitor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver, in particular at the basolateral membrane of hepatocytes near the central vein (PubMed:10779507, PubMed:15159445). Expressed in the placenta (PubMed:12409283). In testis, primarily localized to the basal memb
• Sequence:

  MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
  ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
  YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
  RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
  DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
  TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
  KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
  FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
  YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
  QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
  KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
  NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN

• Sequence length: 702

Pathways

KEGG:

Bile secretion
Folate transport and metabolism

Reactome:

Recycling of bile acids and salts
Heme degradation
Defective SLCO1B3 causes hyperbilirubinemia, Rotor type (HBLRR)
Transport of organic anions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Rotor syndrome	Likely pathogenic; Pathogenic	rs201833947, rs78627909, rs373707046, rs140033394	RCV001802593 RCV001802587 RCV000023445 RCV000779095	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SLCO1B3-related disorder	Pathogenic	rs78627909, rs373707046, rs140033394	RCV003968559 RCV003415733 RCV004751699	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gilbert syndrome	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA, ROTOR TYPE	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	19074900, 23307416		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	28493059		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32607875	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	26641474		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28208135		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	21615622	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24762081		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28447211		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17760952	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33436824	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29658575		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12695556, 19404564, 21615622, 32534581	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24762081		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22326869		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	21615622, 28166633		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	21615622	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19074900		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	29658575	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19074900	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	22326869, 25625007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19074900, 28349822, 28592144, 29491222, 31556849		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	29491222		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	19074900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19074900, 26894861, 28349822, 34599518	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	29491222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	30946364		★☆☆☆☆ Found in Text Mining only
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	BEFREE	25546334		★☆☆☆☆ Found in Text Mining only
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28444661		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28444661		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28444661		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31115461		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23782748, 33917029	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	23998959		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	28097795	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28097795		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	17760952	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29054076		★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	24587300	Associate	★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	24357722		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30946364		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30946364	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19122334		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19122334		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	Pubtator	19419973, 26146841, 38279097	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	26146841, 28063966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperbilirubinemia Hereditary	Hyperbilirubinemia	Pubtator	33860121, 36964102	Associate	★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia Neonatal	Hyperbilirubinemia	Pubtator	26146841, 38279097	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	19122334		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18294295, 23188068		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14739090, 21615622, 24946283, 26105803, 28488786, 29260280		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14739090		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27543206	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	22326869, 25625007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	29577869	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32534581	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28447211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	18648741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22326869		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	22326869, 25625007		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23757163		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23215050, 23307416, 23924606		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18519758, 18537956, 21266523, 21606417, 27537383, 28389619, 30890759		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	21625523		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24762081		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18519758, 20130966, 21395542, 22326869, 22954695, 23215050, 29960051, 31556849		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	21625523		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19074900		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	22326869, 25625007		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17760952		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	25953768	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21212528, 21311410, 23394475, 25056761		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21995462		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	21995462	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17308056, 18519758, 24357722, 24946283, 25611302, 26894861, 29050339, 29146731		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18294295, 23188068		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	LHGDN	18294295		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	18294295, 28817838	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26641474, 30890141		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36988399	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23215050, 23307416, 23924606		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	28493059		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23307416	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	23307416, 28493059		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	23307416	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	14568249		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18537956, 21266523, 21606417, 27537383, 28389619, 30890759		★☆☆☆☆ Found in Text Mining only
Prostatic Cancer, Castration-Resistant	Prostatic Cancer, Castration-Resistant	BEFREE	18519758		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18519758, 18537956		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18537956, 21266523, 21606417, 21625523, 30890759, 33707581	Associate	★☆☆☆☆ Found in Text Mining only
Rotor Syndrome	Rotor Syndrome	BEFREE	22232210, 22954695, 25315738, 25546334		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rotor Syndrome	Rotor Syndrome	GENOMICS_ENGLAND_DG	22232210		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rotor Syndrome	Rotor Syndrome	ORPHANET_DG	22232210		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rotor syndrome	Rotor Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rotor Syndrome	Rotor Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23137910	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24357722		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23137910		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	21625523	Stimulate	★☆☆☆☆ Found in Text Mining only
Unconjugated hyperbilirubinemia	Hyperbilirubinemia	BEFREE	19419973		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21278621	Associate	★☆☆☆☆ Found in Text Mining only