SLCO4A1 (solute carrier organic anion transporter family member 4A1)

Gene

• Entrez ID: 28231
• Gene name: Solute carrier organic anion transporter family member 4A1
• Gene symbol: SLCO4A1
• Synonyms (NCBI Gene): OATP-E, OATP1, OATP4A1, OATPE, OATPRP1, POAT, SLC21A12
• Chromosome: 20
• Chromosome location: 20q13.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017470	hsa-miR-335-5p	Microarray	18185580
MIRT051635	hsa-let-7e-5p	CLASH	23622248
MIRT040640	hsa-miR-92b-3p	CLASH	23622248
MIRT1369425	hsa-miR-1197	CLIP-seq
MIRT1369426	hsa-miR-3155	CLIP-seq
MIRT1369427	hsa-miR-3155b	CLIP-seq
MIRT1369428	hsa-miR-3614-3p	CLIP-seq
MIRT1369429	hsa-miR-3667-3p	CLIP-seq
MIRT1369430	hsa-miR-4297	CLIP-seq
MIRT1369431	hsa-miR-4731-3p	CLIP-seq
MIRT1369432	hsa-miR-4801	CLIP-seq
MIRT1369433	hsa-miR-484	CLIP-seq
MIRT2109679	hsa-miR-371b-3p	CLIP-seq
MIRT2109680	hsa-miR-4663	CLIP-seq
MIRT2109681	hsa-miR-4707-3p	CLIP-seq
MIRT2109682	hsa-miR-4728-3p	CLIP-seq
MIRT2109683	hsa-miR-873	CLIP-seq
MIRT2332952	hsa-miR-1208	CLIP-seq
MIRT2332953	hsa-miR-3121-3p	CLIP-seq
MIRT2332954	hsa-miR-3154	CLIP-seq
MIRT2332955	hsa-miR-3665	CLIP-seq
MIRT2332956	hsa-miR-3671	CLIP-seq
MIRT2332957	hsa-miR-4711-5p	CLIP-seq
MIRT2332958	hsa-miR-657	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	10873595, 19129463
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	10873595
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015349	Function	Thyroid hormone transmembrane transporter activity	IBA
GO:0015711	Process	Organic anion transport	IEA
GO:0015732	Process	Prostaglandin transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070327	Process	Thyroid hormone transport	IEA

Other IDs

• MIM: 612436
• HGNC: 10953
• e!Ensembl: ENSG00000101187

Protein

• UniProt ID: Q96BD0
• Protein name: Solute carrier organic anion transporter family member 4A1 (OATP4A1) (Colon organic anion transporter) (Organic anion transporter polypeptide-related protein 1) (OATP-RP1) (OATPRP1) (POAT) (Organic anion-transporting polypeptide E) (OATP-E) (Sodium-indepe
• Protein function: Organic anion antiporter with apparent broad substrate specificity. Recognizes various substrates including thyroid hormones 3,3',5-triiodo-L-thyronine (T3), L-thyroxine (T4) and 3,3',5'-triiodo-L-thyronine (rT3), conjugated steroids such as est
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03137	OATP	104 → 663	Organic Anion Transporter Polypeptide (OATP) family	Family
  PF07648	Kazal_2	505 → 553	Kazal-type serine protease inhibitor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed (PubMed:10873595, PubMed:11316767). Expressed in placental trophoblasts (PubMed:10873595, PubMed:12409283). Expressed in pancreas, kidney, skeletal muscle, liver, lung, brain, heart, colon, small intestine, ovary, test
• Sequence:

  MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLC
  QLWAEKHGARGTHEVRYVSAGQSVACGWWAFAPPCLQVLNTPKGILFFLCAAAFLQGMTV
  NGFINTVITSLERRYDLHSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLM
  GTGSLVFALPHFTAGRYEVELDAGVRTCPANPGAVCADSTSGLSRYQLVFMLGQFLHGVG
  ATPLYTLGVTYLDENVKSSCSPVYIAIFYTAAILGPAAGYLIGGALLNIYTEMGRRTELT
  TESPLWVGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGEA
  SNPDFGKTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASE
  AATLFGYLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVP
  MAGVTASYGGSLLPEGHLNLTAPCNAACSCQPEHYSPVCGSDGLMYFSLCHAGCPAATET
  NVDGQKVYRDCSCIPQNLSSGFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALT
  ATLRCVRDPQRSFALGIQWIVVRILGGIPGPIAFGWVIDKACLLWQDQCGQQGSCLVYQN
  SAMSRYILIMGLLYKVLGVLFFAIACFLYKPLSESSDGLETCLPSQSSAPDSATDSQLQS
  SV

• Sequence length: 722

Pathways

Reactome:

Transport of organic anions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23307416		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22588260		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21383546	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36863704	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21383546, 37124063	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26349991, 28326039, 28378090, 29734253		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30039525, 31308265, 31853225, 36032659	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35039060	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	23656391		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23656391	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27765905	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19487253	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	34638773	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22588260		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23307416		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25301452, 29734253		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27765905	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23656391	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23307416		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23307416	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	22174898		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25301452		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34773716	Associate	★☆☆☆☆ Found in Text Mining only