GPM6A (glycoprotein M6A)

Gene

• Entrez ID: 2823
• Gene name: Glycoprotein M6A
• Gene symbol: GPM6A
• Synonyms (NCBI Gene): GPM6, M6A
• Chromosome: 4
• Chromosome location: 4q34.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020434	hsa-miR-106b-5p	Microarray	17242205
MIRT024239	hsa-miR-218-5p	Sequencing	20371350
MIRT050918	hsa-miR-17-5p	CLASH	23622248
MIRT498419	hsa-miR-548e-5p	PAR-CLIP	22291592
MIRT498418	hsa-miR-548az-5p	PAR-CLIP	22291592
MIRT498417	hsa-miR-548t-5p	PAR-CLIP	22291592
MIRT498419	hsa-miR-548e-5p	PAR-CLIP	22291592
MIRT498418	hsa-miR-548az-5p	PAR-CLIP	22291592
MIRT498417	hsa-miR-548t-5p	PAR-CLIP	22291592
MIRT1029553	hsa-miR-186	CLIP-seq
MIRT1029554	hsa-miR-200b	CLIP-seq
MIRT1029555	hsa-miR-200c	CLIP-seq
MIRT1029556	hsa-miR-3133	CLIP-seq
MIRT1029557	hsa-miR-374c	CLIP-seq
MIRT1029558	hsa-miR-429	CLIP-seq
MIRT1029559	hsa-miR-4650-3p	CLIP-seq
MIRT1029560	hsa-miR-4773	CLIP-seq
MIRT1029561	hsa-miR-628-5p	CLIP-seq
MIRT1029562	hsa-miR-655	CLIP-seq
MIRT1029563	hsa-miR-1206	CLIP-seq
MIRT1029564	hsa-miR-1283	CLIP-seq
MIRT1029565	hsa-miR-2054	CLIP-seq
MIRT1029566	hsa-miR-221	CLIP-seq
MIRT1029567	hsa-miR-222	CLIP-seq
MIRT1029568	hsa-miR-302a	CLIP-seq
MIRT1029569	hsa-miR-302b	CLIP-seq
MIRT1029570	hsa-miR-302c	CLIP-seq
MIRT1029571	hsa-miR-302d	CLIP-seq
MIRT1029572	hsa-miR-302e	CLIP-seq
MIRT1029573	hsa-miR-3074-3p	CLIP-seq
MIRT1029574	hsa-miR-3153	CLIP-seq
MIRT1029575	hsa-miR-330-3p	CLIP-seq
MIRT1029576	hsa-miR-340	CLIP-seq
MIRT1029577	hsa-miR-361-5p	CLIP-seq
MIRT1029578	hsa-miR-3646	CLIP-seq
MIRT1029579	hsa-miR-365	CLIP-seq
MIRT1029580	hsa-miR-372	CLIP-seq
MIRT1029581	hsa-miR-373	CLIP-seq
MIRT1029582	hsa-miR-409-3p	CLIP-seq
MIRT1029583	hsa-miR-4281	CLIP-seq
MIRT1029584	hsa-miR-448	CLIP-seq
MIRT1029585	hsa-miR-4517	CLIP-seq
MIRT1029586	hsa-miR-4668-5p	CLIP-seq
MIRT1029587	hsa-miR-4763-5p	CLIP-seq
MIRT1029588	hsa-miR-519a	CLIP-seq
MIRT1029589	hsa-miR-519b-3p	CLIP-seq
MIRT1029590	hsa-miR-519c-3p	CLIP-seq
MIRT1029591	hsa-miR-520a-3p	CLIP-seq
MIRT1029592	hsa-miR-520b	CLIP-seq
MIRT1029593	hsa-miR-520c-3p	CLIP-seq
MIRT1029594	hsa-miR-520d-3p	CLIP-seq
MIRT1029595	hsa-miR-520d-5p	CLIP-seq
MIRT1029596	hsa-miR-520e	CLIP-seq
MIRT1029597	hsa-miR-524-5p	CLIP-seq
MIRT1029598	hsa-miR-548v	CLIP-seq
MIRT1029599	hsa-miR-653	CLIP-seq
MIRT2005478	hsa-miR-1178	CLIP-seq
MIRT2005479	hsa-miR-452	CLIP-seq
MIRT2005480	hsa-miR-4676-3p	CLIP-seq
MIRT2450554	hsa-miR-3973	CLIP-seq
MIRT2450555	hsa-miR-450b-5p	CLIP-seq
MIRT2450556	hsa-miR-4731-3p	CLIP-seq
MIRT2450557	hsa-miR-4801	CLIP-seq
MIRT2450558	hsa-miR-507	CLIP-seq
MIRT2450559	hsa-miR-548k	CLIP-seq
MIRT2450560	hsa-miR-556-3p	CLIP-seq
MIRT2450561	hsa-miR-557	CLIP-seq
MIRT2542053	hsa-miR-1305	CLIP-seq
MIRT1029573	hsa-miR-3074-3p	CLIP-seq
MIRT2542054	hsa-miR-3671	CLIP-seq
MIRT2542055	hsa-miR-4643	CLIP-seq
MIRT2542056	hsa-miR-466	CLIP-seq
MIRT2542057	hsa-miR-4789-3p	CLIP-seq
MIRT2542058	hsa-miR-485-3p	CLIP-seq
MIRT2542059	hsa-miR-487a	CLIP-seq
MIRT2542060	hsa-miR-607	CLIP-seq
MIRT2542053	hsa-miR-1305	CLIP-seq
MIRT1029573	hsa-miR-3074-3p	CLIP-seq
MIRT2542054	hsa-miR-3671	CLIP-seq
MIRT2542055	hsa-miR-4643	CLIP-seq
MIRT2542056	hsa-miR-466	CLIP-seq
MIRT2542057	hsa-miR-4789-3p	CLIP-seq
MIRT2542058	hsa-miR-485-3p	CLIP-seq
MIRT2542059	hsa-miR-487a	CLIP-seq
MIRT2542060	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IDA	19298174
GO:0003407	Process	Neural retina development	IEA
GO:0003407	Process	Neural retina development	ISS
GO:0005262	Function	Calcium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	17500595, 24705354, 31286866, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007416	Process	Synapse assembly	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	IEA
GO:0030175	Component	Filopodium	IBA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	ISS
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0044295	Component	Axonal growth cone	IBA
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0045202	Component	Synapse	IEA
GO:0048787	Component	Presynaptic active zone membrane	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0048863	Process	Stem cell differentiation	IDA	19298174
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1903561	Component	Extracellular vesicle	HDA	24769233

Other IDs

• MIM: 601275
• HGNC: 4460
• e!Ensembl: ENSG00000150625

Protein

• UniProt ID: P51674
• Protein name: Neuronal membrane glycoprotein M6-a (M6a)
• Protein function: Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01275	Myelin_PLP	14 → 247	Myelin proteolipid protein (PLP or lipophilin)	Family

• Sequence:

  MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT
  YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT
  TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQF
  GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA
  YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

• Sequence length: 278

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33952721	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32301581, 34705667	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32884942	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32633395	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	36034449	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32323801, 36700472, 37705505, 40197314	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33138349	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32091154, 34359836, 34650549, 35090515, 35609514, 35941582, 36168624, 37466203, 37919739	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34741346, 35592519, 35833147, 35941582, 35982895, 37170222, 37525171, 38097948	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35918602	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36632222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34497315	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34699322, 35784363, 38270643	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35872842, 36058934	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	38168909	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26318878		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35795532	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37975370	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32605475, 33493136, 38479704, 39810713	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18163405		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23392254	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23392254		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36199963	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35852867, 35883571	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33264518, 35572524, 36203569	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	27001847, 35799793, 37149664, 38097948	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	36202899, 37449516	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	25224183		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	32619516	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30991023, 34887874	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37534933	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33428597, 35035657	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36632222	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38250152	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35734168	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26047305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24916915		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37466203	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33490266, 34288419, 35722625	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18163405		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28979185		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35910847	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36310139	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30233315		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34705667	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37006267	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36034449, 37449516	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33431791, 35303054, 35978902, 36066162	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33225598, 35991123, 36259156, 36545327, 38098223	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36632222	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34055982, 35404184, 35609514, 35879877, 37149664	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	23632458		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32869942	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34531875	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	38024481	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18163405, 28979185		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18163405		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18163405		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	25056061, 26198764, 28991256, 29483656, 30285260, 31268507, 31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	36505499, 39287046	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31190355		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35689537, 35910847	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35382776, 35502827, 35730319, 35799793, 35936362, 36193316, 37256823, 38082402	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35090515	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36974635	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38104484	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	26047305		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34733275, 34802433, 36168624	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	37932662	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35572541, 36058934, 37042849, 38250152	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	36199963	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	39343042	Associate	★☆☆☆☆ Found in Text Mining only