Gene Gene information from NCBI Gene database.
Entrez ID 2815
Gene name Glycoprotein IX platelet
Gene symbol GP9
Synonyms (NCBI Gene)
CD42aGPIX
Chromosome 3
Chromosome location 3q21.3
Summary This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. T
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs5030764 A>G Pathogenic-likely-pathogenic, pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs28933377 T>C Pathogenic Missense variant, coding sequence variant
rs28933378 T>C Pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs121918036 A>G Pathogenic Missense variant, coding sequence variant
rs121918037 T>C,G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
2
miRTarBase ID miRNA Experiments Reference
MIRT017185 hsa-miR-335-5p Microarray 18185580
MIRT022106 hsa-miR-125b-5p Other 19738052
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
FLI1 Activation 10194443;15466856
GATA1 Activation 15466856
GATA1 Unknown 11418466;20564185
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 1730602, 25416956, 31515488
GO:0005886 Component Plasma membrane TAS 2771955, 10429193
GO:0007155 Process Cell adhesion IEA
GO:0007155 Process Cell adhesion NAS 2771955
GO:0007596 Process Blood coagulation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
173515 4444 ENSG00000169704
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P14770
Protein name Platelet glycoprotein IX (GP-IX) (GPIX) (Glycoprotein 9) (CD antigen CD42a)
Protein function The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis. G
PDB 3REZ , 8WFS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 19 50 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 51 86 Leucine rich repeat Repeat
Sequence
MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNP
WHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
Sequence length 177
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  ECM-receptor interaction
Platelet activation
Hematopoietic cell lineage
  Intrinsic Pathway of Fibrin Clot Formation
GP1b-IX-V activation signalling
Platelet Adhesion to exposed collagen
Platelet Aggregation (Plug Formation)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Bernard Soulier syndrome Likely pathogenic; Pathogenic rs121918037, rs1946586230, rs2529776939, rs5030764, rs28933377, rs28933378, rs121918038, rs2529777394, rs1297298519, rs769561588 RCV005419304
RCV003326697
RCV003317715
RCV000275909
RCV002222350
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bernard-Soulier syndrome type C Pathogenic; Likely pathogenic rs5030764, rs121918036, rs121918037, rs28933377, rs28933378, rs121918038 RCV000014484
RCV000014485
RCV000014486
RCV000014487
RCV000014488
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
GP9-related disorder Pathogenic rs5030764 RCV003914843
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrothrombocytopenia Pathogenic; Likely pathogenic rs5030764, rs121918037, rs1297298519 RCV000761618
RCV000852069
RCV000761617
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BERNARD-SOULIER SYNDROME CTD, ClinGen, Disgenet, GWAS catalog, HPO, Orphanet
CTD, ClinGen, Disgenet, GWAS catalog, HPO, Orphanet
CTD, ClinGen, Disgenet, GWAS catalog, HPO, Orphanet
CTD, ClinGen, Disgenet, GWAS catalog, HPO, Orphanet
CTD, ClinGen, Disgenet, GWAS catalog, HPO, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BERNARD-SOULIER SYNDROME, TYPE C Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anemia Aplastic Aplastic anemia Pubtator 22315490 Inhibit
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 34394126 Stimulate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma HPO_DG
★☆☆☆☆
Found in Text Mining only
Barber Say syndrome Barber Say Syndrome GENOMICS_ENGLAND_DG 21357716
★☆☆☆☆
Found in Text Mining only
Bernard Soulier Syndrome Bernard-soulier syndrome Pubtator 15609295, 27291889, 29119855, 34553764, 40045897, 7690959, 8407908 Associate
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bernard-Soulier Syndrome Bernard Soulier Syndrome BEFREE 10216092, 10527407, 10583255, 10590056, 10996832, 11167791, 11297032, 11776304, 11937271, 12036872, 12447957, 12463594, 14510954, 15550031, 15609295
View all (23 more)
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bernard-Soulier Syndrome Bernard Soulier Syndrome UNIPROT_DG 10583255, 11167791, 11758225, 12100158, 8481514, 9163595, 9886312
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bernard-Soulier Syndrome Bernard Soulier Syndrome CLINGEN_DG 10583255, 12100158, 15609295, 16916536, 21113250, 21173099, 21699652, 23143686, 23402648, 23995613, 28650483, 8089142, 8481514, 9432024, 9886312
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bernard-Soulier Syndrome Bernard Soulier Syndrome LHGDN 12447957, 12463594, 17763149, 17804902
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bernard-Soulier Syndrome Bernard Soulier Syndrome CLINVAR_DG 14510954, 25370924, 31064749, 8049428, 8481514
★★☆☆☆
Found in Text Mining + Unknown/Other Associations