Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2798
Gene name	Gonadotropin releasing hormone receptor
Gene symbol	GNRHR
Synonyms (NCBI Gene)	GNRHR1GRHRHH7LHRHRLRHR
Chromosome	4
Chromosome location	4q13.2
Summary	This gene encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes,

Show/Hide all (22)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28933074	T>C	Pathogenic	Missense variant, coding sequence variant, synonymous variant
rs74452732	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs104893836	T>C	Pathogenic, pathogenic-likely-pathogenic	Missense variant, coding sequence variant
rs104893837	C>T	Pathogenic	Missense variant, synonymous variant, coding sequence variant
rs104893838	G>A,C,T	Pathogenic	Missense variant, coding sequence variant
rs104893839	G>T	Pathogenic	Missense variant, coding sequence variant
rs104893840	A>T	Pathogenic	Missense variant, coding sequence variant
rs104893841	A>T	Pathogenic	3 prime UTR variant, stop gained, coding sequence variant
rs104893842	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs104893843	A>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs104893844	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893847	G>A	Pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs144900788	G>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs369176613	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, synonymous variant, missense variant
rs515726219	T>C	Pathogenic	Coding sequence variant, missense variant
rs515726220	G>A	Pathogenic	Coding sequence variant, missense variant, synonymous variant
rs606231406	A>G	Pathogenic	Missense variant, coding sequence variant
rs727505367	A>C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs776834867	G>T	Likely-pathogenic	Coding sequence variant, missense variant
rs797044452	C>T	Pathogenic	Intron variant, splice acceptor variant
rs1057520762	A>T	Pathogenic	Coding sequence variant, stop gained, intron variant
rs1064793140	T>C	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022748	hsa-miR-124-3p	Microarray	18668037
MIRT023851	hsa-miR-1-3p	Microarray	18668037
MIRT029569	hsa-miR-26b-5p	Microarray	19088304
MIRT1025594	hsa-miR-1305	CLIP-seq
MIRT1025595	hsa-miR-140-3p	CLIP-seq
MIRT1025596	hsa-miR-153	CLIP-seq
MIRT1025597	hsa-miR-3121-3p	CLIP-seq
MIRT1025598	hsa-miR-3150b-3p	CLIP-seq
MIRT1025599	hsa-miR-3174	CLIP-seq
MIRT1025600	hsa-miR-3619-3p	CLIP-seq
MIRT1025601	hsa-miR-411	CLIP-seq
MIRT1025602	hsa-miR-4496	CLIP-seq
MIRT1025603	hsa-miR-4712-3p	CLIP-seq
MIRT1025604	hsa-miR-4776-5p	CLIP-seq
MIRT1025605	hsa-miR-4784	CLIP-seq
MIRT1025606	hsa-miR-4796-3p	CLIP-seq
MIRT1025607	hsa-miR-4800-5p	CLIP-seq
MIRT1025608	hsa-miR-548a-3p	CLIP-seq
MIRT1025609	hsa-miR-548e	CLIP-seq
MIRT1025610	hsa-miR-548f	CLIP-seq
MIRT1025611	hsa-miR-586	CLIP-seq
MIRT1025612	hsa-miR-1	CLIP-seq
MIRT1025613	hsa-miR-2054	CLIP-seq
MIRT1025614	hsa-miR-206	CLIP-seq
MIRT1025615	hsa-miR-219-2-3p	CLIP-seq
MIRT1025616	hsa-miR-2964a-3p	CLIP-seq
MIRT1025617	hsa-miR-302f	CLIP-seq
MIRT1025618	hsa-miR-3115	CLIP-seq
MIRT1025619	hsa-miR-3145-3p	CLIP-seq
MIRT1025620	hsa-miR-3163	CLIP-seq
MIRT1025621	hsa-miR-3166	CLIP-seq
MIRT1025622	hsa-miR-361-5p	CLIP-seq
MIRT1025623	hsa-miR-3673	CLIP-seq
MIRT1025624	hsa-miR-3944-5p	CLIP-seq
MIRT1025625	hsa-miR-3978	CLIP-seq
MIRT1025626	hsa-miR-4261	CLIP-seq
MIRT1025627	hsa-miR-432	CLIP-seq
MIRT1025628	hsa-miR-4328	CLIP-seq
MIRT1025629	hsa-miR-4506	CLIP-seq
MIRT1025630	hsa-miR-4639-5p	CLIP-seq
MIRT1025631	hsa-miR-4668-3p	CLIP-seq
MIRT1025632	hsa-miR-4680-3p	CLIP-seq
MIRT1025633	hsa-miR-4771	CLIP-seq
MIRT1025634	hsa-miR-486-5p	CLIP-seq
MIRT1025635	hsa-miR-548g	CLIP-seq
MIRT1025636	hsa-miR-613	CLIP-seq
MIRT1025637	hsa-miR-629	CLIP-seq
MIRT1025638	hsa-miR-651	CLIP-seq
MIRT1025639	hsa-miR-656	CLIP-seq
MIRT2004094	hsa-miR-570	CLIP-seq
MIRT2388554	hsa-miR-4760-5p	CLIP-seq
MIRT2450474	hsa-miR-4699-3p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004968	Function	Gonadotropin-releasing hormone receptor activity	IBA
GO:0004968	Function	Gonadotropin-releasing hormone receptor activity	IDA	8386108
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8386108
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8386108
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9259321
GO:0016500	Function	Protein-hormone receptor activity	IEA
GO:0032274	Process	Gonadotropin secretion	NAS	8386108
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	IEA

MIM	HGNC	e!Ensembl
138850	4421	ENSG00000109163

P30968

Protein name

Gonadotropin-releasing hormone receptor (GnRH receptor) (GnRH-R)

Protein function

Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by ass

PDB

7BR3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	60 → 323	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Pituitary, ovary, testis, breast and prostate but not in liver and spleen.

Sequence

MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL

Sequence length

328

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling GnRH signaling pathway		Hormone ligand-binding receptors G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Amenorrhea	Likely pathogenic; Pathogenic	rs104893837, rs104893840	RCV001849268 RCV001849269	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Delayed puberty	Likely pathogenic; Pathogenic	rs727505367	RCV000156945	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GNRHR-related disorder	Likely pathogenic; Pathogenic	rs104893836	RCV003415714	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gonadotropin deficiency	Likely pathogenic; Pathogenic	rs104893836	RCV000662016	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypogonadotropic hypogonadism	Likely pathogenic; Pathogenic	rs104893836, rs104893837, rs104893842	RCV003330392 RCV004782017 RCV005252686	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypogonadotropic hypogonadism 7 with or without anosmia	Pathogenic; Likely pathogenic	rs515726220, rs148499544, rs188272653, rs606231406, rs369176613, rs1325732095, rs1417516934, rs727505367, rs753280668, rs2475805410, rs557311093, rs1237982349, rs104893836, rs104893837, rs28933074 View all (11 more)	RCV000114424 RCV003225761 RCV002497886 RCV000128826 RCV000128827 View all (21 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Infertility disorder	Likely pathogenic; Pathogenic	rs104893836	RCV001327939	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Isolated congenital hypogonadotropic hypogonadism	Likely pathogenic; Pathogenic	rs2475804586, rs104893836	RCV004017999 RCV000599632	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Isolated GnRH Deficiency	Likely pathogenic	rs104893843	RCV000375229	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pituitary hormone deficiency	Likely pathogenic; Pathogenic	rs104893836, rs104893837	RCV005865184 RCV005865185	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC GROWTH HORMONE DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC HYPOGONADOTROPIC HYPOGONADISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KALLMANN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY SHORT STATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHEEHAN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (127)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	11434667, 26397949, 8200967, 9177416, 9425394, 9724070, 9797855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	CTD_human_DG	19131502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	CTD_human_DG	19131502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34128468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	21247312, 29182666, 38521400	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	34833359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30882966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30882966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25706326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25706326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12373298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bartter Syndrome	Bartter syndrome	Pubtator	24472523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26197852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18587256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19640273, 22710726, 23176180, 27098123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18584413, 22051164, 23176180, 26151677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11836606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18587256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24767644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15228417, 17108127, 23164934, 7880073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	22679506, 26720605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	17235395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	9627100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31500399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypogonadotropic hypogonadism	Congenital Hypogonadotropic Hypogonadism	BEFREE	22679506, 22724017, 25531638, 29123501, 29182666, 30476558, 30575316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of breast	Breast hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of ovary	Hypoplasia of the ovary	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	24472523, 27196470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	21330483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	29777911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	38437850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10366462, 11836606, 12373298, 12790790, 7959256, 9467552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	LHGDN	15529183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	10687850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10687850, 28333195, 29476499, 31749075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28333195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Female hypogonadism syndrome	Female Hypogonadism Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22901846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicle stimulating hormone deficiency	Follicle Stimulating Hormone Deficiency	BEFREE	17161329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19360304, 28824547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19360304, 27930095, 28824547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19360304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadotropin deficiency	Gonadotropin Deficiency	BEFREE	12679486, 14714589, 29182666		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	23372819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	16968799, 29182666, 36371229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23176180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	24472523, 26397949, 27196470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	10022417, 12679486, 14689055, 23155690, 29182666		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	Pubtator	12477532, 12568864, 12944565, 16968799, 21277937, 21717411, 22724017, 22745237, 26572316, 27544332, 28485664, 29182666, 36371229	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	LHGDN	12568864, 15105440, 16213849, 18463157		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	CTD_human_DG	15625238		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	Pubtator	38437850	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	BEFREE	11397871, 16868131, 16968799, 23295295, 25016926, 27544332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	CTD_human_DG	15625238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	10523035, 10599708, 10690855, 10698591, 10714361, 10999776, 11299515, 11318785, 11397871, 11420132, 11994356, 12107234, 12477532, 12568864, 14671217 View all (19 more)		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CTD_human_DG	15625238		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	UNIPROT_DG	10022417, 10084584, 10523035, 11318785, 11397842, 11397871, 11994356, 12679486, 23643382, 25077900, 9371856, 9425890		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	10999776, 11079449, 11297587, 11384641, 11397842, 12050282, 12788881, 12944565, 15240592, 15722618, 16213849, 16322390, 16968799, 17161329, 17235395 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CLINVAR_DG	10999776, 11397842, 11397871, 12057744, 12364481, 12568864, 12574221, 15728205, 16968799, 17235395, 22405597, 22724017, 22745237, 22766261, 24732674, 26207952, 28611058, 29182666, 9371856 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	12477532, 16359986, 16500342, 16606836, 17235395, 21247312, 21717411, 22766261, 24002956, 25226293, 33592857, 36700485, 9418701	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	GENOMICS_ENGLAND_DG	9425890		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infertility	Infertility	Pubtator	12477532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated lutropin deficiency (disorder)	Isolated lutropin deficiency	BEFREE	11397842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	11079449, 11531922, 16423815, 16606836, 17235395, 17594608, 18463157, 24776628, 26199944		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kallmann Syndrome 1	Kallmann Syndrome	CLINVAR_DG	22745237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome 2 (disorder)	Kallmann Syndrome	CLINVAR_DG	22745237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22901846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	9627100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19640273, 21279682, 22710726, 23176180, 27098123, 28824547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10366462, 12373298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11836606, 15228417, 17108127, 23164934, 9467552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28824547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19399647, 19640273, 23326338, 26197852, 27756786, 29273727, 30400054, 31033025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18587256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11751060, 18587256, 21541969, 23287110, 28212592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31500399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	7534732, 7789173		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12161512, 14726258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18980792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	29777911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26151677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11836606, 12790790, 15228417, 15233551, 15713894, 18309229, 19360304, 21317933, 23164934, 23326338, 28709956, 30983920, 7534732, 8200967, 8550798, 9467552 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34128468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Normosmic congenital hypogonadotropic hypogonadism	Normosmic Congenital Hypogonadotropic Hypogonadism	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11531922, 12536356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36035370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	16968799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	LHGDN	16968799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15228417, 17108127, 23164934, 7789173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21193558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34128468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	29777911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	15562029, 27901351, 30476149, 30555419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	11037346, 8200967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	10439012, 21274726, 28878336, 29760445, 30476149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35872929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hypogonadism	Hypogonadism	CTD_human_DG	15625238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	30476149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19399647, 19640273, 23326338, 26197852, 27756786, 29273727, 30400054, 31033025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17143537, 23380421, 31614426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	7534732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	15529183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary physiologic amenorrhea	Secondary Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31614426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31614426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular hypogonadism	Testicular Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Selective Pituitary	Thyroid hormone resistance	Pubtator	23341491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31016845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35264044	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33652606, 36806614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22901846, 29476499		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	11079449, 11220702		★★★★★ ★☆☆☆☆ Found in Text Mining only

GNRHR (gonadotropin releasing hormone receptor)