Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2788
Gene name	G protein subunit gamma 7
Gene symbol	GNG7
Synonyms (NCBI Gene)	HG3B
Chromosome	19
Chromosome location	19p13.3

220

Show/Hide all (220)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049296	hsa-miR-92a-3p	CLASH	23622248
MIRT734968	hsa-miR-183-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)	33139493
MIRT735086	hsa-miR-876-5p	Luciferase reporter assayWestern blottingqRT-PCR	34221006
MIRT755527	hsa-miR-146a-3p	qRT-PCRRNA-seqELISA	34728702
MIRT1024550	hsa-miR-1224-5p	CLIP-seq
MIRT1024551	hsa-miR-127-3p	CLIP-seq
MIRT1024552	hsa-miR-129-5p	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024554	hsa-miR-1908	CLIP-seq
MIRT1024555	hsa-miR-22	CLIP-seq
MIRT1024556	hsa-miR-2467-3p	CLIP-seq
MIRT1024557	hsa-miR-3122	CLIP-seq
MIRT1024558	hsa-miR-3136-3p	CLIP-seq
MIRT1024559	hsa-miR-3150b-3p	CLIP-seq
MIRT1024560	hsa-miR-3160-3p	CLIP-seq
MIRT1024561	hsa-miR-3167	CLIP-seq
MIRT1024562	hsa-miR-3175	CLIP-seq
MIRT1024563	hsa-miR-328	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024565	hsa-miR-3613-3p	CLIP-seq
MIRT1024566	hsa-miR-3650	CLIP-seq
MIRT1024567	hsa-miR-3689a-3p	CLIP-seq
MIRT1024568	hsa-miR-3689c	CLIP-seq
MIRT1024569	hsa-miR-371-5p	CLIP-seq
MIRT1024570	hsa-miR-371b-5p	CLIP-seq
MIRT1024571	hsa-miR-3913-5p	CLIP-seq
MIRT1024572	hsa-miR-3915	CLIP-seq
MIRT1024573	hsa-miR-3929	CLIP-seq
MIRT1024574	hsa-miR-3934	CLIP-seq
MIRT1024575	hsa-miR-3942-3p	CLIP-seq
MIRT1024576	hsa-miR-4257	CLIP-seq
MIRT1024577	hsa-miR-4258	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT1024579	hsa-miR-4300	CLIP-seq
MIRT1024580	hsa-miR-4324	CLIP-seq
MIRT1024581	hsa-miR-4329	CLIP-seq
MIRT1024582	hsa-miR-4419b	CLIP-seq
MIRT1024583	hsa-miR-4450	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024585	hsa-miR-4478	CLIP-seq
MIRT1024586	hsa-miR-4487	CLIP-seq
MIRT1024587	hsa-miR-4525	CLIP-seq
MIRT1024588	hsa-miR-4648	CLIP-seq
MIRT1024589	hsa-miR-4649-3p	CLIP-seq
MIRT1024590	hsa-miR-4654	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT1024592	hsa-miR-4689	CLIP-seq
MIRT1024593	hsa-miR-4706	CLIP-seq
MIRT1024594	hsa-miR-4707-3p	CLIP-seq
MIRT1024595	hsa-miR-4720-3p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024597	hsa-miR-4728-5p	CLIP-seq
MIRT1024598	hsa-miR-4730	CLIP-seq
MIRT1024599	hsa-miR-4738-3p	CLIP-seq
MIRT1024600	hsa-miR-4740-3p	CLIP-seq
MIRT1024601	hsa-miR-4746-3p	CLIP-seq
MIRT1024602	hsa-miR-4749-5p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024604	hsa-miR-4769-5p	CLIP-seq
MIRT1024605	hsa-miR-4784	CLIP-seq
MIRT1024606	hsa-miR-4792	CLIP-seq
MIRT1024607	hsa-miR-4798-3p	CLIP-seq
MIRT1024608	hsa-miR-4804-3p	CLIP-seq
MIRT1024609	hsa-miR-485-5p	CLIP-seq
MIRT1024610	hsa-miR-541	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT1024612	hsa-miR-552	CLIP-seq
MIRT1024613	hsa-miR-558	CLIP-seq
MIRT1024614	hsa-miR-603	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT1024616	hsa-miR-654-5p	CLIP-seq
MIRT1024617	hsa-miR-663	CLIP-seq
MIRT1024618	hsa-miR-668	CLIP-seq
MIRT1024619	hsa-miR-920	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT1024551	hsa-miR-127-3p	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT2003860	hsa-miR-24	CLIP-seq
MIRT1024556	hsa-miR-2467-3p	CLIP-seq
MIRT1024557	hsa-miR-3122	CLIP-seq
MIRT2003861	hsa-miR-3150a-3p	CLIP-seq
MIRT1024562	hsa-miR-3175	CLIP-seq
MIRT2003862	hsa-miR-3178	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024567	hsa-miR-3689a-3p	CLIP-seq
MIRT1024568	hsa-miR-3689c	CLIP-seq
MIRT1024571	hsa-miR-3913-5p	CLIP-seq
MIRT2003863	hsa-miR-3926	CLIP-seq
MIRT1024573	hsa-miR-3929	CLIP-seq
MIRT1024576	hsa-miR-4257	CLIP-seq
MIRT1024577	hsa-miR-4258	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT2003864	hsa-miR-4284	CLIP-seq
MIRT2003865	hsa-miR-4292	CLIP-seq
MIRT2003866	hsa-miR-4308	CLIP-seq
MIRT1024582	hsa-miR-4419b	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024585	hsa-miR-4478	CLIP-seq
MIRT2003867	hsa-miR-4486	CLIP-seq
MIRT2003868	hsa-miR-4497	CLIP-seq
MIRT1024589	hsa-miR-4649-3p	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT1024594	hsa-miR-4707-3p	CLIP-seq
MIRT2003869	hsa-miR-4715-3p	CLIP-seq
MIRT1024595	hsa-miR-4720-3p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024597	hsa-miR-4728-5p	CLIP-seq
MIRT1024600	hsa-miR-4740-3p	CLIP-seq
MIRT1024601	hsa-miR-4746-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024608	hsa-miR-4804-3p	CLIP-seq
MIRT1024609	hsa-miR-485-5p	CLIP-seq
MIRT1024610	hsa-miR-541	CLIP-seq
MIRT2003870	hsa-miR-548s	CLIP-seq
MIRT1024613	hsa-miR-558	CLIP-seq
MIRT1024614	hsa-miR-603	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT1024616	hsa-miR-654-5p	CLIP-seq
MIRT2003871	hsa-miR-661	CLIP-seq
MIRT2003872	hsa-miR-939	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT2236631	hsa-miR-1179	CLIP-seq
MIRT2236632	hsa-miR-1234	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024556	hsa-miR-2467-3p	CLIP-seq
MIRT1024560	hsa-miR-3160-3p	CLIP-seq
MIRT2236633	hsa-miR-323b-3p	CLIP-seq
MIRT2236634	hsa-miR-330-3p	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT2003863	hsa-miR-3926	CLIP-seq
MIRT1024573	hsa-miR-3929	CLIP-seq
MIRT1024576	hsa-miR-4257	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT1024582	hsa-miR-4419b	CLIP-seq
MIRT2236635	hsa-miR-4422	CLIP-seq
MIRT2236636	hsa-miR-4433	CLIP-seq
MIRT2236637	hsa-miR-4459	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024585	hsa-miR-4478	CLIP-seq
MIRT1024586	hsa-miR-4487	CLIP-seq
MIRT1024589	hsa-miR-4649-3p	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024601	hsa-miR-4746-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024606	hsa-miR-4792	CLIP-seq
MIRT1024609	hsa-miR-485-5p	CLIP-seq
MIRT2236638	hsa-miR-548ac	CLIP-seq
MIRT2236639	hsa-miR-548ae	CLIP-seq
MIRT2236640	hsa-miR-548aj	CLIP-seq
MIRT2236641	hsa-miR-548am	CLIP-seq
MIRT2236642	hsa-miR-548d-3p	CLIP-seq
MIRT2003870	hsa-miR-548s	CLIP-seq
MIRT2236643	hsa-miR-548x	CLIP-seq
MIRT2236644	hsa-miR-548z	CLIP-seq
MIRT1024613	hsa-miR-558	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT2236645	hsa-miR-873	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT1024577	hsa-miR-4258	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024594	hsa-miR-4707-3p	CLIP-seq
MIRT1024595	hsa-miR-4720-3p	CLIP-seq
MIRT1024608	hsa-miR-4804-3p	CLIP-seq
MIRT1024614	hsa-miR-603	CLIP-seq
MIRT2437450	hsa-miR-615-5p	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT2450457	hsa-miR-4684-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT2540545	hsa-miR-1256	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024565	hsa-miR-3613-3p	CLIP-seq
MIRT2540546	hsa-miR-370	CLIP-seq
MIRT1024569	hsa-miR-371-5p	CLIP-seq
MIRT1024570	hsa-miR-371b-5p	CLIP-seq
MIRT2540547	hsa-miR-4314	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT2540548	hsa-miR-4667-5p	CLIP-seq
MIRT2450457	hsa-miR-4684-5p	CLIP-seq
MIRT2540549	hsa-miR-4700-5p	CLIP-seq
MIRT2540550	hsa-miR-4720-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024599	hsa-miR-4738-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT2540551	hsa-miR-4799-3p	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT2540552	hsa-miR-637	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT2540553	hsa-miR-670	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT2540545	hsa-miR-1256	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024565	hsa-miR-3613-3p	CLIP-seq
MIRT2540546	hsa-miR-370	CLIP-seq
MIRT1024569	hsa-miR-371-5p	CLIP-seq
MIRT1024570	hsa-miR-371b-5p	CLIP-seq
MIRT2540547	hsa-miR-4314	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT2540548	hsa-miR-4667-5p	CLIP-seq
MIRT2450457	hsa-miR-4684-5p	CLIP-seq
MIRT2540549	hsa-miR-4700-5p	CLIP-seq
MIRT2540550	hsa-miR-4720-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024599	hsa-miR-4738-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT2540551	hsa-miR-4799-3p	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT2540552	hsa-miR-637	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT2540553	hsa-miR-670	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001662	Process	Behavioral fear response	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005834	Component	Heterotrimeric G-protein complex	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9600093
GO:0016020	Component	Membrane	IEA
GO:0031681	Function	G-protein beta-subunit binding	IBA
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

MIM	HGNC	e!Ensembl
604430	4410	ENSG00000176533

O60262

Protein name

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

Protein function

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00631	G-gamma	3 → 68	GGL domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues. Down-regulated in pancreatic and esophageal cancer. {ECO:0000269|PubMed:18219292}.

Sequence

MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Chemokine signaling pathway Hormone signaling PI3K-Akt signaling pathway Apelin signaling pathway Circadian entrainment Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse GABAergic synapse Dopaminergic synapse Olfactory transduction Relaxin signaling pathway Morphine addiction Alcoholism Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Pathways in cancer		Activation of G protein gated Potassium channels Glucagon signaling in metabolic regulation G-protein activation Glucagon-like Peptide-1 (GLP1) regulates insulin secretion ADP signalling through P2Y purinoceptor 12 G beta:gamma signalling through PI3Kgamma Prostacyclin signalling through prostacyclin receptor Adrenaline,noradrenaline inhibits insulin secretion Ca2+ pathway G alpha (q) signalling events G alpha (12/13) signalling events G beta:gamma signalling through PLC beta G alpha (s) signalling events ADP signalling through P2Y purinoceptor 1 G alpha (i) signalling events G alpha (z) signalling events Glucagon-type ligand receptors Thromboxane signalling through TP receptor Vasopressin regulates renal water homeostasis via Aquaporins Thrombin signalling through proteinase activated receptors (PARs) Presynaptic function of Kainate receptors Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding G beta:gamma signalling through BTK G beta:gamma signalling through CDC42 Extra-nuclear estrogen signaling ADORA2B mediated anti-inflammatory cytokines production Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32525932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30945310, 37704946	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36938730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32525932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35545337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30945310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	18219292		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	18219292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22183866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22183866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23403885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	37704946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18671701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22183866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18219292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	18219292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	18219292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22183866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35572732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22183866, 30945310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34650124	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	35432200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22183866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23403885, 35240924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22183866, 23403885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36863706	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

GNG7 (G protein subunit gamma 7)