Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2766
Gene name	Guanosine monophosphate reductase
Gene symbol	GMPR
Synonyms (NCBI Gene)	GMPR 1GMPR1hGMPR-I
Chromosome	6
Chromosome location	6p22.3
Summary	This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.[provided by RefSeq, Oct 2009]

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT711706	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT711705	hsa-miR-5193	HITS-CLIP	19536157
MIRT711704	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT711703	hsa-miR-3183	HITS-CLIP	19536157
MIRT711702	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT711701	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT711700	hsa-miR-6841-3p	HITS-CLIP	19536157
MIRT711699	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT711698	hsa-miR-106b-3p	HITS-CLIP	19536157
MIRT711697	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT711696	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT711695	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT711694	hsa-miR-3909	HITS-CLIP	19536157
MIRT711693	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT711692	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT711691	hsa-miR-502-5p	HITS-CLIP	19536157
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT608712	hsa-miR-508-5p	HITS-CLIP	24906430
MIRT608711	hsa-miR-1273g-3p	HITS-CLIP	24906430
MIRT608710	hsa-miR-6849-3p	HITS-CLIP	24906430
MIRT608709	hsa-miR-4722-3p	HITS-CLIP	24906430
MIRT608708	hsa-miR-6727-3p	HITS-CLIP	24906430
MIRT608707	hsa-miR-6747-3p	HITS-CLIP	24906430
MIRT608706	hsa-miR-939-3p	HITS-CLIP	24906430
MIRT608705	hsa-miR-766-3p	HITS-CLIP	24906430
MIRT608703	hsa-miR-4793-3p	HITS-CLIP	24906430
MIRT608704	hsa-miR-1285-3p	HITS-CLIP	24906430
MIRT608701	hsa-miR-3187-5p	HITS-CLIP	24906430
MIRT608702	hsa-miR-5189-5p	HITS-CLIP	24906430
MIRT608700	hsa-miR-612	HITS-CLIP	24906430
MIRT608699	hsa-miR-6860	HITS-CLIP	24906430
MIRT608698	hsa-miR-4252	HITS-CLIP	24906430
MIRT608697	hsa-miR-661	HITS-CLIP	24906430
MIRT608696	hsa-miR-196a-3p	HITS-CLIP	24906430
MIRT608695	hsa-miR-6512-3p	HITS-CLIP	24906430
MIRT608694	hsa-miR-6720-5p	HITS-CLIP	24906430
MIRT608693	hsa-miR-7703	HITS-CLIP	24906430
MIRT711706	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT711705	hsa-miR-5193	HITS-CLIP	19536157
MIRT711704	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT711703	hsa-miR-3183	HITS-CLIP	19536157
MIRT711702	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT711701	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT711700	hsa-miR-6841-3p	HITS-CLIP	19536157
MIRT711699	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT711698	hsa-miR-106b-3p	HITS-CLIP	19536157
MIRT711697	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT711696	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT711695	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT711694	hsa-miR-3909	HITS-CLIP	19536157
MIRT711693	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT711692	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT711691	hsa-miR-502-5p	HITS-CLIP	19536157
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT614570	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT614569	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT614568	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT614567	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT614566	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT614565	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT614564	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT2681681	hsa-miR-185	CLIP-seq
MIRT2681682	hsa-miR-4306	CLIP-seq
MIRT2681683	hsa-miR-4311	CLIP-seq
MIRT2681684	hsa-miR-4644	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0003920	Function	GMP reductase activity	IDA	22332716
GO:0003920	Function	GMP reductase activity	IEA
GO:0003920	Function	GMP reductase activity	TAS	9813009
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005829	Component	Cytosol	TAS
GO:0006144	Process	Purine nucleobase metabolic process	IEA
GO:0006163	Process	Purine nucleotide metabolic process	IEA
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009409	Process	Response to cold	TAS	9813009
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1902560	Component	GMP reductase complex	IEA

MIM	HGNC	e!Ensembl
139265	4376	ENSG00000137198

P36959

Protein name

GMP reductase 1 (GMPR 1) (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase 1) (Guanosine monophosphate reductase 1)

Protein function

Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.

PDB

2BLE , 2BWG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00478	IMPDH	9 → 342	IMP dehydrogenase / GMP reductase domain	Domain

Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
PQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Sequence length

345

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways Nucleotide metabolism		Purine salvage

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GMPR POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37438770	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	40725410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	8750194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASDB_DG	23377640		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	23377640		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	24139804, 27181209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31600844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 2	Hyperoxaluria	Pubtator	31600844	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GMPR (guanosine monophosphate reductase)